EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06645 - SPC12)
FAM  PF06645
PID  SPC12
DES  Microsomal signal peptidase 12 kDa subunit (SPC12)
IPR  IPR009542
ANO  6
ALN  81
AID  0.32213
APH  ((((SPC12_DROME/8-83:0.47517,SPC12_MOUSE/12-89:0.33166):0.24563,SPC12_CAEEL/19-98:0.46602):0.15308,Q8ILC7_PLAF7/23-99:0.66317):0.50751,SPC1_YEAST/16-94:1.27310,SPC12_ARATH/1-80:0.30423);
ATP  ((((SPC12_DROME/8-83,SPC12_MOUSE/12-89),SPC12_CAEEL/19-98),Q8ILC7_PLAF7/23-99),SPC1_YEAST/16-94,SPC12_ARATH/1-80);
ATL  4.54338
DNO  6
DLN  243
DID  0.455516
DPH  (((SPC12_DROME/8-83:0.33137,(SPC12_CAEEL/19-98:0.19326,Q8ILC7_PLAF7/23-99:0.68903):0.19204):0.12581,SPC12_MOUSE/12-89:0.17865):0.46102,SPC1_YEAST/16-94:0.93364,SPC12_ARATH/1-80:0.15872);
DTP  (((SPC12_DROME/8-83,(SPC12_CAEEL/19-98,Q8ILC7_PLAF7/23-99)),SPC12_MOUSE/12-89),SPC1_YEAST/16-94,SPC12_ARATH/1-80);
DTL  3.26354
RID  0.32213
RPH  ((((SPC12_DROME/8-83:0.47517,SPC12_MOUSE/12-89:0.33166):0.24563,SPC12_CAEEL/19-98:0.46602):0.15308,Q8ILC7_PLAF7/23-99:0.66317):0.50751,SPC1_YEAST/16-94:1.27310,SPC12_ARATH/1-80:0.30423);
RTP  ((((SPC12_DROME/8-83,SPC12_MOUSE/12-89),SPC12_CAEEL/19-98),Q8ILC7_PLAF7/23-99),SPC1_YEAST/16-94,SPC12_ARATH/1-80);
RTL  4.54338
LNK  Q8ILC7_PLAF7/23-99:Q8ILC7:AE014821
LNK  SPC12_ARATH/1-80:Q944J0:AF428383
LNK  SPC12_CAEEL/19-98:O44953:AF043693
LNK  SPC12_DROME/8-83:Q9VAL0:AE003769
LNK  SPC12_MOUSE/12-89:Q9D958:AK082928
LNK  SPC1_YEAST/16-94:P46965:U26257
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SPC12_ARATH/1-80
ASQ  MDWQGQKLVEQLMQILLVISGVVAVVVGYTTESFRTMMLIYAGGVVLTTLVTVPNWP-FYNLHPLKWLDPSEAEKHPKPEV
DSQ  ATGGATTGGCAAGGACAGAAACTGGTGGAGCAGCTGATGCAGATCTTACTGGTGATCTCCGGCGTTGTAGCGGTGGTTGTTGGCTACACAACGGAATCGTTCAGGACGATGATGCTGATCTATGCCGGTGGTGTTGTTCTCACGACTTTGGTTACTGTACCTAATTGGCCT---TTCTACAATCTTCATCCTCTCAAATGGTTAGATCCGAGCGAAGCCGAGAAGCATCCCAAACCAGAAGTT
TRN  10010101100011010
NAM  Q8ILC7_PLAF7/23-99
ASQ  MDYCGQNLAYTIRNIIFGISTIISIIVGYYSQSLALSTYIILGGTALASILILPTWP-MYNRNNIEWE---KSYSSSNDKK
DSQ  ATGGACTATTGTGGTCAAAATCTTGCCTATACTATAAGAAATATTATTTTTGGTATTAGTACAATAATATCAATAATTGTTGGATATTACAGTCAAAGTTTAGCATTGAGTACATATATAATATTAGGAGGGACTGCCTTAGCAAGCATTTTAATATTACCAACGTGGCCA---ATGTATAATCGAAACAATATTGAATGGGAA---------AAAAGTTACAGTTCATCAAATGATAAAAAG
TRN  10010101110011000
NAM  SPC12_MOUSE/12-89
ASQ  MDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWP-IYRRHPLKWL-PVQ-DLGTEDKK
DSQ  ATGGATTACAAGGGGCAGAAACTAGCTGAACAGATGTTTCAGGGGATCATTCTTTTTTCTGCAATAGTTGGGTTTATCTACGGGTACGTGGCTGAACAGTTTGGGTGGACTGTCTACATAGTTATGGCCGGATTTGCTTTCTCCTGTTTGCTGACACTTCCTCCATGGCCT---ATCTACCGCCGCCATCCCCTAAAGTGGTTA---CCTGTTCAA---GACTTAGGCACAGAAGACAAGAAA
TRN  10010101100011010
NAM  SPC12_DROME/8-83
ASQ  MDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWP-LYRRNALKWQ---K-PIDTDAKS
DSQ  ATGGACTTCGCGGGTCAGGGAAAGGCGGAGCGCTGGTCGCGCTTCATCATCACGTTCTTCGGAATTGTGGGCCTCGTCTACGGAGCCTTCGTGCAGCAGTTCTCACAGACCGTGTACATCCTGGGCGCCGGATTTGTGCTCTCCTCGCTGATCACCATTCCACCGTGGCCG---CTGTACCGTCGCAATGCGCTCAAATGGCAG---------AAA---CCCATCGATACGGACGCCAAGTCG
TRN  11011101101011001
NAM  SPC12_CAEEL/19-98
ASQ  IDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVLGASAFTALIILPPWPFLFRKNPIVWHTPAE-PQESGDKK
DSQ  ATTGATTTTCAAGGACAGAAAGTCGCCGAGAGAACTTACCAGGTAATCCTCACTATTGCTGGAATTATTGGCTTCCTCGTTGGATTCTGGACTCAACAGCTTTCATATGCCATGTTCACAGTGCTGGGAGCATCTGCGTTCACAGCTCTCATCATTCTTCCACCATGGCCATTCCTCTTCAGAAAGAACCCGATTGTGTGGCACACACCTGCGGAA---CCACAAGAATCTGGAGACAAGAAA
TRN  10010101100011001
NAM  SPC1_YEAST/16-94
ASQ  IDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVITLICVLPAYP-WYNKQKLRWAQP-KIEINVDQYD
DSQ  ATAGATTTTCCCAGCCAACGGAAAACAGAAAAATTTCAACAGCTATCGCTCATGATCGGAGCTTTGGTAGCGTGTATATTGGGATTTGCACAACAGTCCCTGAAAGTTTTACTGACTGCGTATGGCATTAGTTGTGTGATTACTTTAATATGTGTTTTGCCAGCTTACCCA---TGGTATAATAAACAAAAATTGAGGTGGGCACAGCCA---AAAATTGAAATTAATGTCGACCAGTATGAC
TRN  10010101100011010
//