EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06622 - SepQ)
FAM  PF06622
PID  SepQ
DES  SepQ protein
IPR  IPR009532
ANO  2
ALN  305
AID  0.795699
APH  (Q8VNR9_ECOLI/1-305:0.07724,Q93FK4_9ENTR/1-305:0.14657);
ATP  (Q8VNR9_ECOLI/1-305,Q93FK4_9ENTR/1-305);
ATL  0.22381
DNO  2
DLN  915
DID  0.846995
DPH  (Q8VNR9_ECOLI/1-305:0.00000,Q93FK4_9ENTR/1-305:0.17680);
DTP  (Q8VNR9_ECOLI/1-305,Q93FK4_9ENTR/1-305);
DTL  0.1768
RID  0.795699
RPH  (Q8VNR9_ECOLI/1-305:0.07724,Q93FK4_9ENTR/1-305:0.14657);
RTP  (Q8VNR9_ECOLI/1-305,Q93FK4_9ENTR/1-305);
RTL  0.22381
LNK  Q8VNR9_ECOLI/1-305:Q8VNR9:AJ277443
LNK  Q93FK4_9ENTR/1-305:Q93FK4:AF311901
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8VNR9_ECOLI/1-305
ASQ  MNLLNSQLNMKINDFYLPLLSVIGTGRLYITPEGHACHAYFREVSGNGIRFTLTCSGYEGRFWISEEQFIQWCQELFPYSESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKDVYPVIENNNGENRLNVIILEITVQSLQYLINENWQFVPHSNTIFFDGYIAPGWTDYPVTELTVGDSLRLYHVDDSKERECWLVINNPLATVKLCDNNLFIADVQAADLLCTISNEAVMDRIYCVIGTIHVDIHMLRNAKKDDIIDSTGYHLFGGCRLIRNNTTIAYGSIVKINEDFYFTVSLVCD
DSQ  ATGAACCTATTGAATTCTCAATTGAATATGAAAATTAATGATTTTTACTTGCCATTGTTGTCAGTCATAGGAACCGGTCGCCTCTATATTACGCCTGAAGGGCATGCTTGCCATGCATATTTTCGCGAAGTCAGCGGTAATGGTATCCGCTTCACGTTAACATGCTCAGGCTATGAGGGGCGTTTTTGGATATCAGAAGAACAGTTCATTCAGTGGTGCCAGGAGTTATTCCCGTATAGCGAAAGCCGGCTGATACCGGAAGATATGATAAAACTCATGATCTTATGGGTAATGCAGACTGCTTTACCAGAAGGTGATGTGTCTGTTGATGATGTTCAATTTACGATGCTAAATAAAGATGTTTATCCGGTAATAGAAAATAATAATGGAGAAAACAGACTTAATGTAATTATACTCGAAATAACGGTACAGAGTTTACAATATCTAATTAATGAAAATTGGCAATTTGTTCCACATTCTAATACCATTTTCTTTGATGGATATATTGCTCCTGGGTGGACTGATTACCCGGTTACAGAGCTGACTGTTGGTGATAGTTTAAGGCTCTATCATGTTGATGACAGCAAAGAAAGAGAGTGTTGGCTTGTTATTAATAACCCTTTAGCAACCGTAAAACTTTGTGATAATAATTTATTTATTGCGGATGTCCAGGCTGCAGATTTGTTATGTACTATCAGCAATGAGGCTGTAATGGATCGCATTTATTGTGTTATTGGAACAATTCATGTTGATATACATATGTTGCGCAATGCCAAAAAAGATGATATTATCGATTCAACTGGATATCATCTTTTTGGTGGGTGCCGGTTAATACGCAATAATACGACTATAGCATACGGAAGCATTGTAAAAATCAACGAAGATTTTTATTTTACTGTTAGTTTAGTATGTGAT
TRN  10010101100011000
NAM  Q93FK4_9ENTR/1-305
ASQ  MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEGCFWVSEEQLTQWCHELFPYSDSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKDIYPVIENNNGKNRLNVIILKTTVQSLQYLINDNWQLVPHSNTLFFDGYIAPGWTDYPITKLSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNRIYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYSNISVVCD
DSQ  ATGAAGCCATTGAATTCTCAATCGAATATGAAAATTAATGATTTTTACTTACCATTATTACCTGTCATAGGAATCGGTCGCCTCTATATTACGTCCGAAGGGCATGCTTGCCATGCATATTTTCGTGAGGTCAGCGGTAATGGTTTTCGTTTCACGTTGGCATACTCGGGCTATGAGGGGTGTTTTTGGGTATCAGAAGAGCAGCTTACTCAGTGGTGCCATGAGTTATTCCCGTATAGCGATAGTAGATTGATTCCCGAAGATACGATAAAACTCATGCTCCTATGGGCAATACACGCAACATTACCAGAAGATGATGCGTCAGTTGATGATGTTCAATTTACGACGTTAAATAAAGATATTTATCCGGTAATAGAAAATAATAATGGTAAAAACAGACTTAATGTAATTATTCTTAAAACGACGGTACAAAGTTTACAATATCTGATTAATGATAATTGGCAATTAGTTCCGCATTCTAATACTCTTTTTTTTGATGGTTATATCGCACCTGGATGGACTGATTATCCAATTACAAAATTGAGTATTGGTGATAGTTTAAGACTCTATCATGTTGATGATAGTCAAGAGAGAAAATGTTGGCTTGTTATTAATAACCCTTTGGCAACCGTAAAGTTAAGTGATAATAATTTGTCTGTTACGGATGTTCAGGCCGCGGATCCGTTATGTATTATCAGCAACGAGACTGTAATGAATCGTATTTATTGTGCGATTGGTACAATAAATGTCGATATACATAAATTGCGGAATTTAAAAAAAGATGATACTATAGGTTCTGTCGGATATCATCTTTTCGGTGGGGGGCGGTTAATACGGAATAATACAATAATAGCATATGGAACTATTATAAAAATCAATGAGGATTTTTATTCTAATATTAGCGTAGTATGTGAT
TRN  10010101100011000
//