EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06576 - DUF1133)
FAM  PF06576
PID  DUF1133
DES  Protein of unknown function (DUF1133)
IPR  IPR010557
ANO  2
ALN  176
AID  0.802395
APH  (Q8Z611_SALTI/1-176:0.12303,Q8XC85_ECO57/5-180:0.13941);
ATP  (Q8Z611_SALTI/1-176,Q8XC85_ECO57/5-180);
ATL  0.26244
DNO  2
DLN  528
DID  0.729167
DPH  (Q8Z611_SALTI/1-176:0.00000,Q8XC85_ECO57/5-180:0.34257);
DTP  (Q8Z611_SALTI/1-176,Q8XC85_ECO57/5-180);
DTL  0.34257
RID  0.802395
RPH  (Q8Z611_SALTI/1-176:0.12303,Q8XC85_ECO57/5-180:0.13941);
RTP  (Q8Z611_SALTI/1-176,Q8XC85_ECO57/5-180);
RTL  0.26244
LNK  Q8XC85_ECO57/5-180:Q8XC85:AE005174
LNK  Q8Z611_SALTI/1-176:Q8Z611:AL627272
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8Z611_SALTI/1-176
ASQ  MIYPTNTGKSGEHLRLTTLESVWIQGKLRMWGRWSYIGGGKTGNMFNQLLTSKKLTKTAINEALRRMKKAGLDKPELEAFLRDMINGKQKSWLVHCTDAEALCIDRVISEVLAEHPGLICILRQRYEGRGMTKRKMAELLNDAHPEWCFRTCCSRVDVWLNLAEYMLYLPMRDAFS
DSQ  GTGATTTACCCAACGAATACAGGAAAAAGCGGAGAACACCTTCGTCTCACCACGCTGGAAAGTGTCTGGATTCAGGGAAAACTGCGTATGTGGGGGCGCTGGTCGTATATTGGTGGCGGTAAGACGGGAAATATGTTCAACCAGTTGCTGACCTCTAAAAAGCTGACAAAAACGGCAATTAACGAGGCGCTCCGGAGGATGAAAAAAGCAGGTCTGGACAAACCTGAACTTGAGGCTTTTTTGCGGGATATGATCAACGGCAAGCAAAAAAGCTGGCTGGTGCATTGTACTGATGCAGAGGCGTTATGCATTGATCGGGTGATTAGTGAAGTGCTGGCAGAACACCCAGGATTGATTTGTATCCTCCGGCAACGATATGAAGGGAGGGGGATGACTAAGCGAAAAATGGCTGAATTGCTGAATGACGCACACCCTGAGTGGTGTTTCCGGACGTGCTGCAGTCGGGTAGATGTATGGCTAAATCTTGCTGAATATATGCTCTATCTACCGATGCGTGATGCATTCTCT
TRN  10010101100011010
NAM  Q8XC85_ECO57/5-180
ASQ  MIYPEITGKSGEHLRLNTLEAVWIQGKLRMWGRWSYIGGGKSGNMFNRLLVSKKLTKTAVNEVLRSMKKSGLEKPELEAFFRDMTRGKQKSWLSHCTDTEALIIDRVISEVLGEYPGLINILRQRYEGRGMSKRKMAECLNRTHPEWCFSTCEKRIAGWLAVAEHMLYVPMHDSFR
DSQ  ATGATATATCCGGAAATTACAGGCAAAAGCGGCGAACATTTACGCCTGAACACGCTGGAAGCAGTCTGGATCCAGGGGAAATTACGGATGTGGGGGCGGTGGTCGTATATCGGTGGGGGTAAATCCGGAAATATGTTTAACCGGTTACTGGTTTCGAAAAAGCTGACGAAAACAGCAGTTAATGAGGTTTTACGCAGCATGAAGAAATCCGGGCTGGAAAAACCGGAACTTGAGGCATTTTTTCGGGATATGACCAGAGGGAAGCAGAAGAGCTGGTTGTCACATTGTACAGACACAGAGGCGTTGATTATTGATCGCGTTATCAGTGAGGTGCTTGGGGAATATCCCGGGCTAATCAATATTCTCCGGCAAAGGTACGAAGGACGGGGAATGAGTAAGAGAAAAATGGCAGAATGTTTAAATCGTACTCACCCGGAATGGTGTTTCAGCACATGTGAGAAACGTATTGCAGGTTGGTTAGCCGTGGCTGAACACATGCTTTATGTACCTATGCACGATTCATTTCGA
TRN  10010101100011000
//