EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06570 - DUF1129)
FAM  PF06570
PID  DUF1129
DES  Protein of unknown function (DUF1129)
IPR  IPR009214
ANO  7
ALN  223
AID  0.363714
APH  ((Q8Y3R6_LISMO/14-220:0.74229,Q88T15_LACPL/28-239:0.84859):0.34559,(Q8CZ91_STRR6/11-225:0.53356,((Q8NZJ1_STRP3/1-212:0.24006,Q8DXY5_STRA5/1-213:0.28492):0.08682,Q8DSE2_STRMU/1-213:0.43573):0.13269):0.19257,Q9CJ13_LACLA/3-212:0.48538);
ATP  ((Q8Y3R6_LISMO/14-220,Q88T15_LACPL/28-239),(Q8CZ91_STRR6/11-225,((Q8NZJ1_STRP3/1-212,Q8DXY5_STRA5/1-213),Q8DSE2_STRMU/1-213)),Q9CJ13_LACLA/3-212);
ATL  4.3282
DNO  7
DLN  669
DID  0.481511
DPH  ((Q8DXY5_STRA5/1-213:0.27830,Q8NZJ1_STRP3/1-212:0.23379):0.08474,Q8DSE2_STRMU/1-213:0.29295,(((Q88T15_LACPL/28-239:0.58126,Q8Y3R6_LISMO/14-220:0.57832):0.20936,Q9CJ13_LACLA/3-212:0.32411):0.15485,Q8CZ91_STRR6/11-225:0.43739):0.07124);
DTP  ((Q8DXY5_STRA5/1-213,Q8NZJ1_STRP3/1-212),Q8DSE2_STRMU/1-213,(((Q88T15_LACPL/28-239,Q8Y3R6_LISMO/14-220),Q9CJ13_LACLA/3-212),Q8CZ91_STRR6/11-225));
DTL  3.24631
RID  0.363714
RPH  ((Q8Y3R6_LISMO/14-220:0.74229,Q88T15_LACPL/28-239:0.84859):0.34559,(Q8CZ91_STRR6/11-225:0.53356,((Q8NZJ1_STRP3/1-212:0.24006,Q8DXY5_STRA5/1-213:0.28492):0.08682,Q8DSE2_STRMU/1-213:0.43573):0.13269):0.19257,Q9CJ13_LACLA/3-212:0.48538);
RTP  ((Q8Y3R6_LISMO/14-220,Q88T15_LACPL/28-239),(Q8CZ91_STRR6/11-225,((Q8NZJ1_STRP3/1-212,Q8DXY5_STRA5/1-213),Q8DSE2_STRMU/1-213)),Q9CJ13_LACLA/3-212);
RTL  4.3282
LNK  Q88T15_LACPL/28-239:Q88T15:AL935261
LNK  Q8CZ91_STRR6/11-225:Q8CZ91:AE008400
LNK  Q8DSE2_STRMU/1-213:Q8DSE2:AE015012
LNK  Q8DXY5_STRA5/1-213:Q8DXY5:AE014269
LNK  Q8NZJ1_STRP3/1-212:Q8NZJ1:BA000034
LNK  Q8Y3R6_LISMO/14-220:Q8Y3R6:AL591984
LNK  Q9CJ13_LACLA/3-212:Q9CJ13:AE006257
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CJ13_LACLA/3-212
ASQ  NLIEELTAKNKEYIHSVTKQLILVGKSDEEVKEILNDILPQIIEGQKSGIIARKLLG-APTEFVTQYQPKVADR--PVSEKNENPVLMWLDSSLLFLGFISLLNGVTALITSK-AP-----VYGLITTILSAAVAGLVMYMMYRYFYRPKA---DNSRRTWNWKGFAATTLSVLLWIAVTIFSGL-LPTSVNLQLPAIALVIVGLVAFGVRWLLKRQFNIQSA
DSQ  AATTTAATCGAAGAACTTACTGCTAAAAATAAAGAATACATTCATTCGGTAACGAAACAACTGATTTTAGTTGGGAAATCAGATGAAGAAGTTAAAGAAATCTTGAATGACATTCTTCCGCAAATTATTGAAGGTCAAAAATCAGGAATTATTGCTCGTAAATTATTGGGA---GCGCCAACTGAATTTGTTACTCAATATCAACCAAAAGTTGCTGACAGA------CCTGTCAGTGAAAAAAATGAAAATCCAGTTTTGATGTGGCTTGATAGTAGCCTACTCTTTTTAGGATTTATTTCTCTTTTAAATGGAGTAACCGCACTTATCACTTCTAAA---GCTCCG---------------GTTTATGGCTTGATTACAACAATCTTGTCAGCGGCAGTTGCTGGTTTGGTAATGTATATGATGTATCGTTACTTTTATCGTCCTAAAGCG---------GATAACAGTCGTAGAACTTGGAATTGGAAAGGTTTTGCAGCAACCACTCTGTCAGTTCTCCTTTGGATTGCGGTAACTATCTTCTCTGGCCTT---TTGCCAACATCAGTTAATTTGCAACTTCCTGCAATTGCTTTAGTTATTGTTGGACTTGTAGCCTTTGGAGTTCGTTGGCTCTTGAAACGTCAATTTAACATTCAATCTGCT
TRN  10010101100011000
NAM  Q8NZJ1_STRP3/1-212
ASQ  MELQELTKKNQEFIHTATNKLIQDGKSDEDIKLILEEAIPAILENQKKGVTARNLLG-TPTAWAASFSQDPSQRA-AETDKNTNPWLMWLDTSLLFIGIVALLNGIMTFFNTN-AT-----VTGLISLLALGFGGGASMYATYYFIYRHLG--KDKSLRPSWFKIIAALSLAMLIWIALYSATAF-LPTSLNPQLPPLALLIIGGVSLALRYYLQRKYNIQNT
DSQ  ATGGAATTACAAGAACTTACCAAAAAAAATCAAGAATTTATCCACACCGCTACGAACAAATTAATCCAAGACGGCAAGTCTGATGAGGATATTAAGCTGATTCTCGAAGAAGCCATTCCAGCTATTCTAGAAAACCAGAAAAAAGGTGTCACCGCTCGAAATCTATTAGGC---ACTCCGACTGCTTGGGCAGCTTCTTTTAGCCAAGACCCTAGTCAAAGAGCA---GCAGAAACTGACAAAAACACCAATCCTTGGTTGATGTGGCTAGATACCTCTTTGCTATTCATCGGAATTGTTGCCCTTTTAAATGGCATCATGACCTTCTTCAACACAAAC---GCTACA---------------GTTACAGGATTGATTTCCTTACTGGCACTTGGTTTTGGTGGAGGAGCATCCATGTACGCTACTTATTACTTTATTTACCGTCATCTCGGA------AAAGATAAGAGCCTTCGTCCAAGTTGGTTCAAAATCATCGCAGCCTTATCATTAGCCATGTTGATTTGGATTGCCTTGTACTCTGCGACTGCCTTT---TTACCAACCTCTCTTAACCCACAGTTGCCTCCTCTTGCCTTGCTCATTATTGGTGGTGTTTCCCTTGCTTTACGCTATTACCTACAACGCAAATACAACATTCAAAACACT
TRN  10010101100011000
NAM  Q8DXY5_STRA5/1-213
ASQ  MTLQDLTKKNQEFVHIATNQLLADGKSDAEIKAILEEHLPEIIDNQKKGITARSLLG-APTTWAASFTERPEDKARVSVQKNTNPWLMWLDTSLLFLGLVTALNGLMLLFGQS-NV-----NTGLISILTLGFGGGAAMYVTYYYIYRHMG--KPKSERPGWLKSFAVLALVMLVWFALFAVVPL-LPATINPKLPEVVLFIIALASFGLRFYLQRKYNIQSS
DSQ  ATGACTTTACAAGACTTAACTAAAAAGAATCAAGAGTTTGTTCATATTGCAACTAATCAACTTTTAGCTGATGGAAAATCAGATGCAGAAATCAAAGCTATTTTAGAAGAACATCTCCCAGAGATTATAGATAATCAGAAAAAAGGAATTACCGCACGCTCACTCTTAGGA---GCACCAACTACTTGGGCAGCCTCATTCACTGAGCGACCTGAGGATAAAGCTAGAGTATCTGTACAAAAAAATACCAATCCTTGGTTGATGTGGTTAGATACTTCCTTACTATTTCTTGGCTTAGTAACTGCTTTGAATGGTTTAATGTTGCTATTTGGTCAATCT---AATGTC---------------AATACAGGGCTTATTTCAATTTTAACTCTTGGTTTTGGTGGTGGTGCGGCCATGTACGTTACTTATTACTATATTTATCGCCATATGGGT------AAACCAAAATCTGAAAGACCAGGCTGGCTTAAATCTTTCGCAGTACTGGCACTAGTTATGTTAGTTTGGTTTGCCTTATTTGCAGTAGTACCTCTT---CTACCTGCAACTATTAATCCTAAACTTCCTGAGGTTGTTTTGTTTATTATTGCTTTAGCATCGTTTGGTTTGCGCTTTTATTTACAACGTAAATATAATATTCAAAGCTCA
TRN  10010101100011000
NAM  Q8DSE2_STRMU/1-213
ASQ  MDVQNLTKKNQEFINIVTHQLLQSGKSDEDIQTILAKTLPEIIEKQKQGIPARSFLG-APTAWAAQFIETEQNKSTASAPKNTNPWLMWLDTSLFFLAVVTLITGFLNFFSKQ-AP-----TYGIVTLTFLGFGGGAIMFLTYHFFYRYSG--MPKNERPSFIKSFGILAFFMIFWMFLYAATGF-LPAFLNPKVPGFVLLVICALAFGIRYLLKKKYNIENA
DSQ  ATGGATGTACAAAATCTTACTAAAAAAAATCAAGAATTCATCAATATTGTAACACATCAATTGCTCCAATCAGGCAAATCCGATGAAGATATTCAAACTATTCTCGCCAAGACTTTACCTGAAATTATCGAAAAACAAAAGCAAGGAATCCCTGCACGTTCTTTTTTGGGT---GCACCAACTGCTTGGGCAGCTCAATTTATTGAAACAGAACAAAACAAGTCAACAGCTTCTGCTCCTAAAAATACAAATCCCTGGCTTATGTGGCTAGATACTTCCCTCTTCTTCCTTGCTGTTGTGACCTTAATAACAGGATTTTTAAATTTTTTTAGCAAACAA---GCACCT---------------ACCTACGGGATTGTGACACTTACCTTTCTTGGCTTTGGTGGCGGTGCTATCATGTTTTTAACTTATCACTTTTTCTATCGCTACTCAGGA------ATGCCTAAAAATGAACGTCCTAGTTTTATCAAATCATTTGGGATCTTAGCATTCTTCATGATTTTTTGGATGTTTCTTTATGCAGCAACAGGCTTC---TTACCAGCTTTTCTCAATCCCAAAGTTCCAGGCTTCGTCTTGCTTGTTATTTGTGCCCTCGCTTTTGGTATTCGTTATCTGCTTAAGAAAAAATATAATATTGAAAATGCT
TRN  10010101100011000
NAM  Q8CZ91_STRR6/11-225
ASQ  IDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQILEEQSKGTTARSLYG-APTHWAHSFTVK-EQYEKEHPKENDDPKLMIMDSALFITSLFALVSALTTFFAADQAF-----GYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRPPFWKSVLVILASMFLWLLVFFATSF-LPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSV
DSQ  ATTGATCTACAAAAATTAACTAAGAAAAACCAAGAGTTTGTCCACATTGCTACCCAACAATTCATCAAAGATGGGAAAACAGACGCTGAAATCCAGACTATTTTTGAGGAAGTCATTCCCCAAATCCTTGAGGAGCAATCTAAAGGTACAACTGCCCGTTCCCTATACGGC---GCACCAACTCATTGGGCTCATAGCTTCACTGTCAAA---GAGCAGTACGAAAAAGAGCATCCAAAAGAAAATGATGACCCAAAACTGATGATTATGGACTCAGCTCTTTTCATCACTAGCCTCTTTGCCCTTGTCAGCGCCCTCACAACCTTCTTTGCGGCAGACCAAGCTTTC---------------GGCTATGGATTGATTACTCTTCTATTAGTTGGACTGGTTGGTGGATTTGCCTTCTACTTGATGTACTACTTTGTTTACCAATACTATGGACCAGATATGGATCGCAGTCAACGTCCACCTTTCTGGAAATCTGTACTAGTTATCCTAGCTTCTATGTTCCTTTGGTTGCTTGTCTTCTTTGCAACAAGCTTC---CTACCAGCTAGCCTTAACCCAGTACTGGATCCATTGCCACTAGCTATTATTGGAGCAGCCCTCCTAGCCCTTCGCTTCTATCTCAAGAAACGCTTGAATATCCGTAGTGTA
TRN  11011101101011000
NAM  Q8Y3R6_LISMO/14-220
ASQ  ELKANLTKRNLQYVMEVEKHLRETHYGEEQQEIIVYEMSEKILAEQKKGITARKLFNLTPTEYVVSLDVK-----AATVEQNTDKWWLVLDGGLLVLGAMMLISGISAYFQKN-AQ-----TLGIIVLLITAVVGGFAMLILRKYA-----SNMRAGQKGGTIKYLLVAVGVIAVWMFVMTIVQVTIPPNINVALSPIVNTVGGAIIIALRFYVKKKKNIPSL
DSQ  GAATTGAAAGCTAATTTAACGAAGCGGAACTTGCAATATGTTATGGAAGTCGAAAAGCATTTGCGAGAAACTCATTACGGCGAAGAACAACAAGAAATTATTGTTTATGAAATGAGTGAAAAGATTTTAGCCGAACAGAAAAAAGGCATCACAGCGAGAAAATTATTTAATTTAACACCAACAGAATATGTTGTTTCTTTAGATGTGAAA---------------GCTGCTACAGTGGAGCAAAACACGGATAAATGGTGGCTAGTACTTGACGGTGGACTCCTTGTACTTGGAGCGATGATGCTGATTTCAGGAATTAGTGCTTATTTCCAAAAAAAT---GCACAG---------------ACTTTAGGAATTATCGTGTTATTAATCACTGCAGTTGTCGGTGGCTTCGCAATGCTTATCTTGCGTAAATACGCT---------------TCTAACATGCGCGCTGGTCAAAAAGGTGGAACAATAAAATACTTACTAGTAGCGGTCGGAGTCATTGCGGTATGGATGTTTGTAATGACGATTGTACAAGTGACAATTCCTCCAAATATTAATGTAGCGTTAAGTCCGATTGTTAACACAGTTGGTGGTGCAATTATTATTGCCCTACGTTTCTATGTGAAGAAAAAGAAAAATATTCCATCCTTA
TRN  10010101100011000
NAM  Q88T15_LACPL/28-239
ASQ  HEATELTKRNAEYMRQMRKSLDATALSGEKKTAVLNEMTSTLLAEQGRGTTARQLYG-TVQERTEEIV---NPKKTPVERQKANYWVTALDNGLMLFMIFCLMYGIMGFIGTN-ATKNSAGANGITAILITSAIGGLGVAKLFEYL-----MPAKDGKKVSLWKKIAWSVLAIIVWMLVFTTMSM-IQGPLNPVLPGIAYLIIAVVVFFARMWLKRRFNITTS
DSQ  CACGAAGCGACTGAGTTGACGAAGCGCAATGCTGAATATATGCGTCAGATGCGCAAGTCACTTGATGCCACAGCGTTGAGTGGTGAGAAAAAGACGGCAGTTCTGAATGAAATGACGTCTACATTGTTAGCGGAACAAGGTCGGGGAACCACGGCTCGTCAATTATACGGG---ACCGTTCAAGAACGGACCGAAGAGATTGTG---------AATCCAAAAAAGACACCGGTAGAACGTCAAAAGGCGAACTATTGGGTCACGGCGCTGGATAATGGCTTGATGCTATTCATGATTTTCTGCTTAATGTACGGGATCATGGGCTTCATCGGCACGAAC---GCTACTAAGAATTCAGCTGGTGCCAACGGGATCACCGCTATTCTGATTACGTCCGCCATTGGTGGTTTGGGCGTTGCTAAGTTATTCGAATACTTA---------------ATGCCTGCTAAAGATGGCAAGAAAGTTTCGTTATGGAAGAAAATCGCGTGGTCAGTACTGGCTATCATCGTTTGGATGTTAGTCTTTACAACCATGTCAATG---ATTCAAGGGCCATTGAACCCGGTCTTACCAGGAATCGCGTACTTGATCATTGCCGTCGTCGTCTTCTTCGCCCGGATGTGGTTGAAGCGGCGCTTTAATATTACGACGAGC
TRN  11011101101011000
//