EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06556 - ASFV_p27)
FAM  PF06556
PID  ASFV_p27
DES  IAP-like protein p27 C-terminus
IPR  IPR010549
ANO  2
ALN  131
AID  0.898305
APH  (IAPL_ASFM1/94-224:0.05238,IAPL_ASFM2/108-238:0.06063);
ATP  (IAPL_ASFM1/94-224,IAPL_ASFM2/108-238);
ATL  0.113
DNO  2
DLN  393
DID  0.928753
DPH  (IAPL_ASFM1/94-224:0.00191,IAPL_ASFM2/108-238:0.07436);
DTP  (IAPL_ASFM1/94-224,IAPL_ASFM2/108-238);
DTL  0.07627
RID  0.898305
RPH  (IAPL_ASFM1/94-224:0.05238,IAPL_ASFM2/108-238:0.06063);
RTP  (IAPL_ASFM1/94-224,IAPL_ASFM2/108-238);
RTL  0.113
LNK  IAPL_ASFM1/94-224:O11452:U91737
LNK  IAPL_ASFM2/108-238:O11453:U91738
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IAPL_ASFM1/94-224
ASQ  ATLGIIGLKKMIDSYNDYYNNEVFVKHKNRVYTHKRLEDMGFSKPFMQFILANAFIPPYRKYIHKIILNDRYFTFKFAAHLLSFHKVNLDNQTTYCMTCGIEPIKKDENFCNACKTLNYKHYKTLNFSVKL
DSQ  GCAACCTTGGGCATTATAGGACTTAAAAAAATGATTGATAGCTATAACGACTATTATAACAATGAAGTTTTTGTAAAACACAAAAATAGGGTTTATACCCACAAAAGATTAGAAGATATGGGGTTTTCCAAGCCCTTTATGCAATTTATTTTGGCAAATGCTTTCATTCCTCCTTATCGAAAATATATTCATAAGATCATTTTAAATGACCGATATTTTACTTTTAAATTTGCGGCTCACTTACTTTCCTTTCATAAAGTTAATCTTGATAATCAAACAACATATTGTATGACATGTGGCATTGAACCAATTAAAAAAGATGAAAATTTCTGCAATGCATGCAAAACACTTAATTATAAACACTATAAAACACTGAATTTTAGTGTCAAACTT
TRN  10010101100011010
NAM  IAPL_ASFM2/108-238
ASQ  ATLGIIGLKKMIDSYNDYFTNEVSVKHKNRVYTHKRLEDMGFSKSFMRFILANAFMPPYRKYIHKIILNERYFTFKFVAYLLSFHKVNLDNQITYCMTCGIEQINKDENFCNACKPLNYKHYKILNFSVKL
DSQ  GCAACCTTGGGCATTATAGGACTTAAAAAAATGATTGATAGTTATAATGACTATTTTACCAATGAAGTTTCTGTAAAACACAAAAATAGAGTTTACACCCACAAAAGGTTAGAAGATATGGGTTTTTCCAAGTCTTTTATGCGATTTATTTTGGCAAATGCTTTCATGCCTCCTTATCGAAAATATATTCATAAGATTATTTTAAATGAAAGATATTTTACTTTTAAATTTGTAGCTTACCTGCTTTCCTTTCATAAAGTTAATCTTGATAACCAAATAACATATTGTATGACATGTGGTATTGAACAAATTAATAAAGATGAAAATTTCTGCAATGCATGCAAACCACTTAATTATAAACACTATAAAATACTGAATTTTAGTGTCAAACTT
TRN  10010101100011010
//