EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06501 - Herpes_U55)
FAM  PF06501
PID  Herpes_U55
DES  Human herpesvirus U55 protein
IPR  IPR009479
ANO  3
ALN  439
AID  0.270608
APH  (V55B_HHV7J/5-430:1.49708,VU55_HHV6U/3-432:0.70532,O56289_9BETA/6-427:0.70525);
ATP  (V55B_HHV7J/5-430,VU55_HHV6U/3-432,O56289_9BETA/6-427);
ATL  2.90765
DNO  3
DLN  1317
DID  0.429786
DPH  (V55B_HHV7J/5-430:0.81529,VU55_HHV6U/3-432:0.48067,O56289_9BETA/6-427:0.43200);
DTP  (V55B_HHV7J/5-430,VU55_HHV6U/3-432,O56289_9BETA/6-427);
DTL  1.72796
RID  0.270608
RPH  (V55B_HHV7J/5-430:1.49708,VU55_HHV6U/3-432:0.70532,O56289_9BETA/6-427:0.70525);
RTP  (V55B_HHV7J/5-430,VU55_HHV6U/3-432,O56289_9BETA/6-427);
RTL  2.90765
LNK  O56289_9BETA/6-427:O56289:AF037218
LNK  V55B_HHV7J/5-430:P52518:U43400
LNK  VU55_HHV6U/3-432:P24435:X83413
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  V55B_HHV7J/5-430
ASQ  TSDILKYVQIEIPYKEEFQGKDNVTLLFDEYVQSKTEPVLLLSAE-INSRNSDSFFSARPLMEEQQLKLHLKNLNRHIYPSKVLFFGFPLLKINSSIVIIP--------NHDVKEQEQMGVFPSLIRFKNEKVIVTQTPHKVNEITVTMFNIEWKLSTYQRSIERTPGHPLTTLCTVCSVNINNLPFWFHDVRSGSDFPTCKVFSISDPTVSVLKMIFSPPLLEIYLRCYTEVTKNNTYMVPNDCMLKLGFVNEIIPNEISLTVHMHYFKICSDKRKIDVFFQDTMLFDEGETKKLHFKGTFYNFNANALYVPDPNSKVQSIASFWSPTTSFTTKVTSDRSQRVTTNDIIGSIYFIPTHILRTKFDPNYTDSFAAEIELNSEDPESDALYFLADKIFISDLPDLILRKGWSARKKKLQSGSNIN----NHAPSKSRLRF
DSQ  ACTTCTGATATCTTAAAATATGTTCAGATTGAAATTCCATACAAAGAAGAATTCCAGGGTAAAGATAATGTTACATTATTATTTGACGAGTATGTCCAATCAAAAACTGAACCAGTTTTACTTTTGAGCGCTGAA---ATAAATTCAAGGAATTCTGACTCCTTTTTTTCTGCTCGTCCTTTAATGGAAGAACAACAACTAAAACTACATTTAAAAAATCTGAATAGACACATTTATCCATCAAAAGTCTTGTTTTTTGGATTTCCGTTGTTAAAAATTAACAGCTCTATCGTCATCATCCCA------------------------AACCATGATGTTAAAGAACAAGAGCAGATGGGAGTTTTTCCTAGTCTGATAAGATTCAAAAACGAAAAGGTCATAGTGACGCAAACCCCACATAAAGTAAACGAAATAACCGTCACGATGTTTAACATTGAATGGAAACTAAGTACTTATCAACGTTCGATTGAAAGAACACCTGGCCATCCATTAACAACTCTATGTACAGTCTGCTCTGTTAACATAAACAATTTACCTTTTTGGTTTCACGATGTTCGGAGTGGTTCAGATTTTCCAACGTGCAAAGTGTTTTCTATTTCAGACCCAACAGTTTCCGTACTTAAAATGATCTTTTCTCCTCCTCTACTCGAAATCTATCTTCGATGTTATACAGAGGTAACTAAAAATAACACGTATATGGTTCCAAACGATTGCATGCTTAAACTTGGTTTTGTCAACGAAATAATCCCAAACGAAATTTCTCTAACTGTGCATATGCATTACTTTAAAATCTGTAGCGATAAAAGAAAAATTGACGTTTTTTTCCAAGACACGATGCTTTTCGATGAGGGCGAAACTAAAAAACTTCATTTTAAAGGCACTTTTTATAATTTTAATGCTAATGCTCTCTACGTTCCAGACCCAAATTCCAAAGTGCAGTCTATTGCTTCTTTCTGGTCTCCCACTACAAGTTTTACCACAAAAGTGACTAGTGATAGATCGCAGAGAGTGACTACAAATGACATAATAGGCAGCATTTATTTTATCCCAACGCATATTTTACGAACTAAATTTGATCCCAACTATACGGATAGTTTTGCTGCTGAAATTGAGCTTAACTCAGAAGATCCAGAATCTGACGCACTGTATTTTTTAGCAGACAAAATTTTTATCTCTGATTTGCCAGATTTAATCTTAAGAAAAGGTTGGAGCGCTCGTAAAAAAAAATTGCAATCTGGATCAAATATAAAT------------AACCACGCCCCTTCAAAAAGTAGATTGCGGTTT
TRN  10010101100011000
NAM  VU55_HHV6U/3-432
ASQ  SPQLNHVLQLVFDCNH-IVSN-SYQEIILKCRISSTKPGILFITDGTESETEDVLFDVQFLEKTTTIKIKILPISRTV-PVRIHLFSIPIYLPSHALEIDDINALCQKENIDPTVYEQYGLTNMPISTTNVINQFKVVQNDSVEMSLILFNLNWTESPYQSQKLDRYGRKLLIVFSVFSIDTRECPYWENLFK--SIIPLCRVNMISEPGISIYKIEFNDPFLTVFLRNVVLPENKRRFPITKECYLRLTF-SPPDRSTVTLNMNMPYFKICADGKNLEVFFPNDMSLVSNTNKEITLRGEFTNKKIVGIFIPVQTHVFKLYPFLWFAQEPLKLRISCERTVSVTEHDMLGRVFFVTKKLFRKPFRSLSNSDMKSLLTHTENTDKPFDVHFMGNCFPAYLLPELTLHPL---EYEDKPARGNPQTLPSVEKHSIIKIRI
DSQ  TCTCCTCAACTAAACCATGTCTTGCAACTCGTTTTTGATTGCAATCAC---ATAGTTTCGAAT---TCTTACCAAGAAATCATTTTGAAATGTCGAATCTCAAGCACAAAACCAGGAATCCTATTCATAACAGATGGCACTGAATCGGAAACTGAGGACGTTCTGTTCGATGTACAGTTTCTCGAAAAAACAACGACTATCAAAATAAAAATTTTACCTATTTCTAGGACGGTT---CCCGTACGGATTCATTTATTTTCCATACCCATTTATCTGCCGTCACATGCACTGGAGATTGACGACATCAATGCGCTATGTCAAAAAGAAAACATCGATCCGACCGTATACGAACAATATGGCCTAACCAATATGCCTATCTCGACAACCAACGTGATAAATCAATTTAAAGTAGTTCAGAATGATAGCGTTGAAATGTCTTTGATCTTATTTAACCTAAACTGGACAGAAAGTCCTTATCAGTCTCAAAAATTAGACCGCTATGGCAGAAAGCTGCTAATAGTTTTTAGCGTGTTCAGCATCGATACCAGAGAATGTCCCTATTGGGAAAACCTATTCAAA------AGTATCATCCCACTCTGCAGAGTCAACATGATTTCCGAACCCGGCATCTCTATCTACAAAATAGAATTTAACGATCCTTTTCTCACAGTCTTTTTGCGTAACGTAGTGTTGCCGGAAAACAAGCGACGGTTTCCAATCACGAAAGAATGTTATCTTCGCTTGACCTTT---TCCCCCCCTGATCGGAGCACCGTCACGCTAAATATGAATATGCCGTATTTTAAAATCTGCGCAGACGGGAAGAATCTAGAGGTTTTCTTTCCCAACGATATGTCCTTAGTAAGTAATACAAACAAAGAGATCACGCTACGCGGCGAGTTCACTAACAAAAAAATCGTAGGCATCTTCATCCCTGTCCAGACGCATGTCTTCAAGCTGTATCCATTTTTATGGTTTGCCCAAGAACCGTTAAAATTGCGGATTTCGTGCGAAAGAACAGTTTCCGTAACCGAACACGACATGTTAGGGCGTGTCTTTTTTGTGACGAAGAAGTTGTTTAGAAAGCCGTTTCGTTCACTCTCAAACAGCGACATGAAATCTCTTTTAACACACACGGAGAATACCGATAAACCATTCGACGTACACTTCATGGGCAATTGTTTTCCTGCATACTTGCTACCGGAACTCACATTACATCCCTTA---------GAATACGAAGACAAGCCTGCGCGTGGAAACCCGCAGACTCTCCCGTCCGTGGAAAAACACTCTATTATAAAAATACGCATA
TRN  10010101100011000
NAM  O56289_9BETA/6-427
ASQ  VSELSQLIQFTVDFND-LQPELNFSPAEITCILSHERPVLLLITDGTENNAECVTLVGHVLKNKKVIKINVFPMIQSI-NF-VNIFALPIFNITSSLLIQDNCYF--KENMDPLRFHQFAYLEKGLGTTPII--LYSVKNGDLIVNATVTKITWEKNEFQPLLKNSNDQRLETMYCIFTFNTTYCKYWNVFFA--SATPICNVEMISEHNVSVYKIEYRSPVLFVFLR--YLKVMNSRFCVD-ECSLRLRF-SKPNMQSVALNICMPYFNISEEFKTMEIYFPERMTLTPNHITQINLRGTFENPAAVGLFIPKKSNVLS-FPFIWQPRETFRIYVYCRNETFVTEHDIIGHVYFISREQFPHSFHPTAHADCKSKVEAAFNS---FRINFLGNDFFSDSLPILTVHPMTDFPYEQIQETENIRHNSMNITPRFKRMQL
DSQ  GTCTCTGAATTATCGCAATTAATTCAGTTTACTGTGGATTTTAATGAT---TTGCAGCCAGAACTCAATTTTTCTCCCGCAGAGATTACCTGCATACTTTCGCACGAAAGACCTGTACTGTTGCTAATTACCGATGGAACTGAAAACAATGCAGAATGCGTAACTTTGGTGGGTCACGTTCTAAAAAACAAAAAAGTGATCAAAATTAATGTTTTTCCTATGATACAATCGATA---AACTTT---GTCAATATTTTTGCCCTGCCAATTTTTAACATTACGTCATCCCTGCTGATACAAGATAATTGTTACTTT------AAAGAAAATATGGATCCTCTTAGATTTCATCAATTTGCCTATCTTGAAAAGGGTTTAGGAACAACTCCTATAATT------TTATATTCTGTGAAAAATGGTGATCTGATCGTAAATGCCACAGTAACTAAAATTACTTGGGAAAAGAATGAATTTCAACCTTTACTGAAAAACTCCAATGATCAAAGACTGGAAACCATGTACTGCATCTTCACCTTCAATACAACATACTGCAAATATTGGAATGTTTTTTTCGCG------AGCGCAACGCCAATCTGCAACGTGGAAATGATATCAGAACACAATGTTTCGGTGTACAAGATTGAATATCGATCACCGGTGTTATTTGTCTTTCTACGG------TATCTTAAAGTAATGAATTCACGTTTCTGTGTGGAT---GAGTGTTCTTTACGCTTAAGATTT---TCTAAACCAAATATGCAATCAGTTGCACTTAACATTTGCATGCCGTATTTCAATATTTCTGAAGAATTCAAAACAATGGAAATTTATTTCCCTGAAAGAATGACACTGACACCTAATCACATCACACAAATCAATTTACGAGGAACCTTTGAGAATCCTGCTGCTGTAGGGCTATTCATTCCAAAGAAATCTAATGTACTCTCA---TTTCCTTTCATTTGGCAACCGCGTGAGACTTTTAGAATTTACGTGTACTGCCGAAATGAGACATTTGTAACGGAGCATGATATAATTGGTCATGTCTACTTTATCAGTAGAGAACAATTTCCACATTCTTTCCATCCTACAGCACACGCAGATTGCAAATCAAAAGTTGAAGCCGCTTTCAATTCA---------TTTCGAATTAACTTTTTAGGGAACGATTTTTTTTCAGACTCTCTCCCAATTTTGACAGTTCATCCCATGACAGACTTTCCCTACGAACAAATACAAGAGACAGAAAACATTAGACATAACTCTATGAACATAACACCCCGCTTCAAACGTATGCAATTG
TRN  10010101100011000
//