EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06500 - DUF1100)
FAM  PF06500
PID  DUF1100
DES  Protein of unknown function (DUF1100)
IPR  IPR010520
ANO  5
ALN  416
AID  0.554259
APH  (((Y328_VIBVU/4-414:0.11675,Y674_VIBPA/4-414:0.14443):0.12524,Y2276_VIBCH/4-414:0.10581):0.70434,Y3224_YERPE/1-415:0.18418,YAFA_ECOLI/1-414:0.28641);
ATP  (((Y328_VIBVU/4-414,Y674_VIBPA/4-414),Y2276_VIBCH/4-414),Y3224_YERPE/1-415,YAFA_ECOLI/1-414);
ATL  1.66716
DNO  5
DLN  1248
DID  0.569424
DPH  (Y328_VIBVU/4-414:0.16963,Y674_VIBPA/4-414:0.16674,((Y3224_YERPE/1-415:0.22172,YAFA_ECOLI/1-414:0.25030):0.48882,Y2276_VIBCH/4-414:0.18195):0.09809);
DTP  (Y328_VIBVU/4-414,Y674_VIBPA/4-414,((Y3224_YERPE/1-415,YAFA_ECOLI/1-414),Y2276_VIBCH/4-414));
DTL  1.57725
RID  0.554259
RPH  (((Y328_VIBVU/4-414:0.11675,Y674_VIBPA/4-414:0.14443):0.12524,Y2276_VIBCH/4-414:0.10581):0.70434,Y3224_YERPE/1-415:0.18418,YAFA_ECOLI/1-414:0.28641);
RTP  (((Y328_VIBVU/4-414,Y674_VIBPA/4-414),Y2276_VIBCH/4-414),Y3224_YERPE/1-415,YAFA_ECOLI/1-414);
RTL  1.66716
LNK  Y2276_VIBCH/4-414:Q9KPT6:AE004299
LNK  Y3224_YERPE/1-415:Q8D170:AJ414156
LNK  Y328_VIBVU/4-414:Q8DF91:AE016798
LNK  Y674_VIBPA/4-414:Q87RV2:AP005075
LNK  YAFA_ECOLI/1-414:P04335:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y2276_VIBCH/4-414
ASQ  ASSKNLSETLFQNHKQAKETSSLTQYMPSSL--ELLDTRREQSSQAWYRNLRRLQWIWQGVDPVEQEEILARIASSKHSRTHDEWLDTVMGYRSGNWTYEWTRVGMLHQKQAAERQGE-EAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEAAKLTGFVVKRLEFSYQN-KKIAGYLHLRN-TDSPKPVVLVSAGLDSLQTDMWRLFRDYLAKRDIAMLTIDMPSLGASSHWPLTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMARLAFLESDKVKACVSLGAPIHDIFTSPNKLAAMPKMYLDVLASRLGKNVVDVRSLSGQLMAWSLKVQGFMSGRRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGYEQSLDLAINWLEDELC
DSQ  GCGAGCAGCAAAAACCTGTCTGAGACCCTGTTTCAAAATCACAAACAAGCTAAAGAGACATCTTCGCTTACCCAATATATGCCAAGCAGTTTA------GAGCTGTTAGACACTCGCCGAGAACAATCATCCCAAGCTTGGTACCGTAATTTGCGCCGTTTACAGTGGATTTGGCAGGGCGTTGATCCGGTTGAGCAGGAAGAGATCCTGGCGCGGATTGCCTCTTCTAAGCATTCGCGCACTCACGATGAGTGGCTTGATACTGTGATGGGATATCGCAGTGGTAACTGGACCTACGAATGGACGCGCGTTGGCATGCTGCATCAAAAGCAAGCGGCGGAGCGTCAAGGAGAA---GAGGCGGCCGATCAAATGTTTGCCGCGGCGCTCTATTACAGCATCGCGGGTTATCCTCATCTTCGAAACGACAACTTGGCTTTACAAGCCCAAGTGCTCGCAAACAATGCTTATCAAGAAGCGGCAAAACTGACGGGATTTGTGGTTAAGCGCTTAGAGTTTTCCTATCAAAAC---AAAAAAATTGCTGGTTATTTGCATCTACGTAAT---ACCGATTCTCCAAAGCCTGTGGTGCTGGTTAGTGCGGGGTTAGATAGCTTACAAACTGATATGTGGCGTCTATTTCGCGACTATTTAGCCAAGCGAGATATCGCCATGCTGACCATTGATATGCCGTCACTGGGCGCAAGCTCTCACTGGCCATTGACTGAAGATTCCTCCTGCTTGCATCAAGCGGTACTGAACCAGCTGGCAGATCTGCCTTGGGTGGATCATTTCCGTATCGGGCTGATTGGTTTTCGTTTTGGTGGGAATGCGATGGCGCGGCTGGCTTTTCTCGAGTCGGATAAGGTGAAAGCTTGTGTTTCACTTGGCGCGCCAATTCACGATATTTTCACCTCCCCTAATAAGTTGGCCGCCATGCCAAAAATGTATCTTGATGTACTGGCGTCACGTTTAGGCAAAAACGTAGTCGATGTGCGCAGCTTATCCGGACAATTGATGGCATGGTCGCTAAAAGTGCAGGGTTTTATGTCTGGCCGCAGAACCAAAACGCCGATTTTAGCACTGGGATTGGAAGGGGATCCGGTATCGCCTTATTCAGACAACCAACTCGTGGCACTCTTTAGCCAAGGTGGGCAAGCGAAGAAAGTAAAAAGTAAAACAATTTCACAGGGATATGAGCAATCCCTCGATTTGGCAATAAACTGGCTAGAAGATGAACTTTGC
TRN  10010101100011000
NAM  Y328_VIBVU/4-414
ASQ  EVSKNLSETLFVKHKQAKETSALTQYMPTSQ--SLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNE-AASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKKSKYIIKQLEIPFEK-GKITAHLHLTN-TDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLSSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQSLDLAIKWLEDELL
DSQ  GAAGTCAGCAAAAACCTGTCAGAAACGCTATTTGTCAAACATAAGCAAGCCAAAGAAACCTCGGCATTGACTCAATACATGCCGACCAGCCAA------TCCTTACTTGATGAAATTAAAGAGAAGAATGGTTTTTCTTGGTATCGCAACCTTCGTCGCTTGCAATGGGTGTGGCAAGGTGTCGATCCTATTGAGCAAGAACAAGTATTGGCTCGTATTGCCTCTTCCAAACATTCACGCACTGATGAGCAATGGCTCGATACGGTGATGGGATATCACAGTGGTAACTGGGCTTATGAATGGACGAGGCTCGGTATGGAGCATCAAAAGCGTGCCGGTGAGATGACGAATGAA---GCAGCATCGGAAGCGCTCTTCTCCGCATCCTTGTGTTACAGCATCGCAGGTTACCCACACCTCAAGAGCGATAATTTGGCCATTCAAGCACAAGTTTTGGCCAACAGCGCTTATCTTGAAGCCGCGAAAAAAAGCAAATACATCATTAAGCAGCTCGAGATCCCATTTGAGAAA---GGGAAGATCACCGCGCACTTGCATCTGACCAAT---ACGGATAAACCGCATCCTGTGGTTATTGTGAGTGCGGGATTAGACAGTCTGCAAACCGACATGTGGCGTCTATTTCGAGATCACCTTGCCAAGCACGATATTGCCATGTTGACAGTAGACATGCCATCGGTGGGGTACAGCTCAAAATACCCATTAACGGAGGATTACAGTCGCCTTCACCAAGCGGTGTTGAACGAGCTTTTCTCTATTCCTTATGTCGATCATCATCGAGTGGGTTTGATCGGCTTTCGTTTTGGCGGTAACGCCATGGTGAGGCTCTCGTTCCTTGAGCAAGAAAAGATCAAAGCGTGCGTTATCTTAGGCGCACCTATTCATGATATTTTTGCCTCCCCACAGAAATTGCAGCAAATGCCGAAGATGTATCTCGATGTCTTAGCCTCGCGTTTAGGTAAGAGTGTGGTAGATATTTACAGCTTATCGGGGCAAATGGCCGCGTGGTCACTGAAAGTACAAGGCTTTTTGAGCAGTCGTAAAACCAAGGTGCCTATCTTGGCGATGAGCTTAGAAGGGGATCCGGTCTCGCCATATTCGGATAATCAGATGGTTGCTTTTTTTAGCACTTATGGAAAAGCGAAGAAAATCAGTTCCAAAACAATTACACAAGGATATGAGCAATCCCTCGATTTAGCGATAAAGTGGCTGGAAGATGAACTCTTA
TRN  10010101100011000
NAM  Y674_VIBPA/4-414
ASQ  DVSKNLSETLFVKHKQAKETSALTQYMPTSK--KILDDREQQEDRAWYRHLRRLQWAWQGLSPIEMEGVLSRIASSTHSRTHDDWLDTVMGYHSGNWTFEWIKLGMEHQRRANDLKGE-DAADELFTASLCFSIAGYPHLKNDNLALQAQVLANKAYSEGAEKTQYTIKQIEVPYQK-RKIIANLHLPR-TDKQLPVVMVSAGLDSLQTDMWRLFRNHFAPKDIAMLTVDMPSVGHSSHWPLTEDSSCLHQAVLNELYSIPYVDHHKVGLVGFRFGGNAMVRLSFLEQEKIKACVALGAPVHDLFTSPKKLQKMPKMYLDMLASRLGKSAVDINSMAGQMMAWSLKVQGFLSSRKTKVPILALSLEGDPVSPYSDNQLVALFSHYGQAKKISSKTITKGYEQSLDLAIKWLEDELL
DSQ  GACGTCAGTAAAAATCTTTCCGAGACTTTGTTCGTAAAACATAAGCAAGCGAAAGAAACCTCCGCGCTCACTCAATACATGCCAACCAGCAAA------AAGATTCTTGATGATCGAGAACAGCAAGAAGATCGTGCTTGGTATCGTCATTTGCGTCGCTTGCAGTGGGCGTGGCAAGGCTTATCTCCAATTGAAATGGAAGGCGTGTTGTCGCGCATTGCTTCGTCAACGCATTCTCGTACTCACGATGATTGGTTAGATACTGTGATGGGGTATCACAGTGGTAACTGGACGTTTGAGTGGATCAAGTTAGGTATGGAACACCAACGACGTGCCAATGATCTTAAAGGTGAG---GATGCTGCCGACGAGCTGTTTACCGCATCGTTGTGTTTCAGCATTGCGGGCTATCCTCATTTAAAAAACGACAACTTGGCGCTTCAGGCTCAGGTGTTAGCAAACAAAGCCTATTCTGAAGGGGCTGAGAAAACTCAATACACCATCAAGCAAATTGAGGTGCCTTACCAAAAA---CGCAAAATTATCGCTAACTTGCATTTGCCAAGA---ACCGATAAGCAGCTGCCAGTTGTGATGGTGAGTGCAGGACTCGACAGTTTACAAACCGACATGTGGCGCTTGTTCCGCAATCACTTTGCTCCTAAAGATATTGCAATGCTAACCGTCGATATGCCATCAGTCGGACACAGTTCTCATTGGCCTTTGACGGAAGATTCAAGCTGTCTTCATCAAGCCGTGTTGAATGAGCTTTATTCCATTCCTTACGTTGATCATCACAAAGTTGGTTTGGTCGGTTTCCGTTTTGGTGGCAATGCCATGGTTCGTCTGTCTTTTCTTGAGCAAGAAAAGATCAAAGCGTGTGTGGCACTAGGCGCACCGGTGCATGATCTGTTTACCTCGCCGAAAAAGCTGCAAAAAATGCCGAAGATGTATCTGGATATGTTGGCTTCTCGTTTGGGTAAAAGCGCAGTTGATATCAACAGCATGGCTGGGCAGATGATGGCTTGGTCATTGAAAGTTCAAGGCTTCTTGAGCAGTCGTAAAACTAAGGTGCCAATTTTAGCGCTGAGCTTAGAAGGTGACCCCGTTTCTCCTTACAGTGACAACCAGTTAGTCGCGCTATTTAGCCACTATGGGCAGGCGAAGAAGATCAGTTCCAAGACAATTACAAAAGGATATGAGCAATCCCTCGATTTGGCGATAAAGTGGTTGGAAGATGAATTATTA
TRN  10010101100011000
NAM  YAFA_ECOLI/1-414
ASQ  MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGGAPITGFLHMPK-GDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLL-GRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITDWIEKRLC
DSQ  ATGACACAGGCAAACCTGAGCGAAACCCTGTTCAAACCCCGCTTTAAACATCCTGAAACCTCGACGCTAGTCCGCCGCTTTAATCACGGCGCACAACCGCCTGTGCAGTCGGCCCTTGATGGTAAAACCATCCCTCACTGGTATCGCATGATTAACCGTCTGATGTGGATCTGGCGCGGCATTGACCCACGCGAAATCCTCGACGTCCAGGCACGTATTGTGATGAGCGATGCCGAACGTACCGACGATGATTTATACGATACGGTGATTGGCTACCGTGGCGGCAACTGGATTTATGAGTGGGCCACCCAGGCGATGGTGTGGCAACAAAAAGCCTGTGCGGAAGACGATCCGCAACTCAGTGGTCGTCACTGGCTGCATGCGGCTACGTTGTACAACATTGCCGCCTATCCTCATCTGAAAGGAGATGACCTGGCCGAGCAAGCGCAGGCTTTGTCAAACCGCGCCTATGAAGAGGCCGCTCAGCGTCTACCGGGCACGATGCGGCAGATGGAGTTTACCGTACCCGGCGGTGCGCCCATCACCGGCTTTTTGCATATGCCGAAA---GGCGATGGCCCGTTCCCGACGGTATTAATGTGTGGTGGTCTGGATGCGATGCAGACGGACTATTACAGCCTGTATGAACGTTATTTTGCGCCGCGCGGCATTGCGATGCTGACTATTGATATGCCGTCGGTGGGCTTTTCTTCAAAATGGAAGCTCACCCAGGACTCCAGCCTGTTGCATCAGCACGTCTTAAAGGCGCTGCCTAACGTACCGTGGGTGGATCACACTCGCGTCGCGGCCTTTGGTTTCCGTTTCGGCGCTAACGTTGCCGTGCGTCTGGCATACCTTGAATCGCCGCGTCTGAAAGCGGTTGCCTGTCTTGGTCCGGTAGTTCATACCCTGTTGAGTGATTTTAAGTGCCAGCAACAGGTGCCGGAAATGTATCTTGACGTTCTGGCCAGTCGTTTGGGGATGCATGATGCTTCCGATGAAGCGTTGCGCGTGGAGCTGAATCGCTATTCATTAAAAGTGCAAGGATTGCTG---GGACGTCGCTGCCCAACGCCAATGTTATCAGGCTACTGGAAGAACGATCCGTTCAGCCCGGAAGAGGACTCACGCTTAATCACCTCATCATCTGCTGACGGTAAATTATTAGAGATCCCATTTAACCCGGTGTATCGGAATTTTGACAAAGGTCTTCAGGAAATCACCGACTGGATCGAAAAACGCTTGTGT
TRN  11011101101011000
NAM  Y3224_YERPE/1-415
ASQ  MAQANLSEILFKPKFKHPETSTLVRRTHCNHVVNIHSALDGDTANHWYRMINRLMWTWRGIDPLEIEEVLSRIACSKAEHSNNELLDTVVGYRNGNWIYEWANQGMMWQQKAMEETDPGSAGQFWLNAANLYSIASYPHLKGDELSEQAEVLSNRAYEEAAKYLPYTLKELTFPISDGGSLSGFLHMPTVGSAPFPTVLMCGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRWKLTQDTSYLHQQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPIVHHLLCNSDSLRKVPDMYMDVMASRLGMADSTDETLNTEMNRYSLKTQGLL-GRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENFHRALLQTSEWLEDKMR
DSQ  ATGGCACAAGCCAACCTTTCTGAAATTCTGTTCAAACCCAAATTCAAACATCCAGAAACCTCAACTCTCGTACGGCGTACCCATTGCAACCACGTCGTGAATATCCATTCGGCGTTGGATGGTGATACCGCCAACCATTGGTATCGGATGATTAATCGTCTGATGTGGACTTGGCGTGGCATTGATCCCCTTGAAATAGAAGAGGTCTTATCGCGTATTGCCTGTTCCAAAGCGGAGCACAGTAATAACGAGTTATTGGATACCGTGGTGGGTTACCGTAATGGTAACTGGATTTATGAATGGGCCAATCAGGGGATGATGTGGCAACAAAAAGCGATGGAAGAAACCGATCCGGGGAGCGCAGGTCAGTTCTGGCTGAATGCGGCTAATTTGTACAGCATTGCCAGTTACCCACATCTAAAGGGCGATGAGCTGTCGGAGCAGGCAGAGGTGCTGTCAAACCGTGCTTATGAAGAGGCGGCCAAATATCTACCGTACACCTTAAAAGAGCTGACGTTCCCCATTTCGGATGGCGGTTCGCTGTCAGGTTTCTTACACATGCCTACTGTTGGCAGCGCACCTTTCCCAACGGTACTGATGTGCGGTGGTCTAGATACGTTACAAAGTGATTACCACCGCCTATTCCGTGATTATCTAGAACCCAAGGGTATCGCGATGTTGACCATCGACCTGCCATCTGTGGGGGCCTCATCCCGCTGGAAGCTCACGCAAGATACCAGTTATCTACATCAGCAAGTGTTACAGGCGTTAGCGGATGTCCCGTGGGTTGACCATCAGCGCGTTAGTGTGTTCGGTTTTCGTTTTGGGGCTAACGTGGCCGTACGTTTGGGGTATTTAGAACCACAAAGGGTACGTGCAGTCGCATGCCTTGGGCCGATTGTTCATCACTTGCTGTGTAACAGCGATAGCCTACGTAAAGTGCCTGACATGTATATGGATGTCATGGCTAGCCGGTTGGGTATGGCGGATTCGACAGATGAGACGTTGAACACCGAAATGAACCGTTATTCGCTGAAAACCCAAGGTTTGCTG---GGGCGGCGTTGTCAGACACCTATGCTGGCCGGTTTTTGGGAGAATGACCCCTTCAGTCCAAAAGAAGAAGCTAAATTGATCTGCTCTTCTTCTGCTGACGGTAAGTTGTTAGCTATCCCGTCTAAACCGCTCTATGAGAATTTCCATCGTGCATTATTGCAAACCAGCGAATGGTTAGAAGATAAAATGCGT
TRN  10010101100011000
//