EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06460 - NSP13)
FAM  PF06460
PID  NSP13
DES  Coronavirus NSP13
IPR  IPR009461
ANO  8
ALN  316
AID  0.518988
APH  ((((R1AB_IBVK/219-521:0.32102,R1AB_BEV/2033-2271:1.50896):0.14740,(R1AB_CVPFS/234-533:0.18890,(R1AB_CVH22/6459-6758:0.12845,R1AB_PEDV7/6481-6780:0.12421):0.06911):0.22356):0.08769,R1AB_CVHSA/6777-7073:0.22611):0.21115,R1AB_CVMA5/6879-7175:0.10415,R1AB_CVBQ/6797-7054:0.24733);
ATP  ((((R1AB_IBVK/219-521,R1AB_BEV/2033-2271),(R1AB_CVPFS/234-533,(R1AB_CVH22/6459-6758,R1AB_PEDV7/6481-6780))),R1AB_CVHSA/6777-7073),R1AB_CVMA5/6879-7175,R1AB_CVBQ/6797-7054);
ATL  3.58802
DNO  5
DLN  948
DID  0.534085
DPH  (((R1AB_IBVK/219-521:0.23883,R1AB_BEV/2033-2271:0.86184):0.13910,R1AB_CVHSA/6777-7073:0.32496):0.12763,R1AB_CVPFS/234-533:0.24845,R1AB_CVH22/6459-6758:0.18550);
DTP  (((R1AB_IBVK/219-521,R1AB_BEV/2033-2271),R1AB_CVHSA/6777-7073),R1AB_CVPFS/234-533,R1AB_CVH22/6459-6758);
DTL  2.12631
RID  0.465208
RPH  (((R1AB_IBVK/219-521:0.34591,R1AB_BEV/2033-2271:1.49861):0.11350,R1AB_CVHSA/6777-7073:0.27182):0.24215,R1AB_CVPFS/234-533:0.21125,R1AB_CVH22/6459-6758:0.16339);
RTP  (((R1AB_IBVK/219-521,R1AB_BEV/2033-2271),R1AB_CVHSA/6777-7073),R1AB_CVPFS/234-533,R1AB_CVH22/6459-6758);
RTL  2.84663
LNK  R1AB_BEV/2033-2271:P18458:X52374
LNK  R1AB_CVBQ/6797-7054:Q8V6W7:
LNK  R1AB_CVH22/6459-6758:Q05002:AF304460
LNK  R1AB_CVHSA/6777-7073:P59641:AY278741
LNK  R1AB_CVMA5/6879-7175:P16342:
LNK  R1AB_CVPFS/234-533:P18457:X53128
LNK  R1AB_IBVK/219-521:P12723:M21515
LNK  R1AB_PEDV7/6481-6780:Q91AV2:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..............................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  R1AB_PEDV7/6481-6780
ASQ  ASEWKCGYSMPSIYKIQRMCLEPCNLYNYGAGVKLPDGIMFNVVKYTQLCQYLNSTTMCVPHHMRVLHLGAGSDKGVAPGTAVLRRWL..........PLDAIIVDNDSVDYVSDADYSVTGDCSTLYLSDKFDLVISDMY----DGKIKSCDGENVSKEGFFPYI-NGVITEKLALGGTVAIKVTEFSW-NKKLYELIQKFEYWTMFCTSVNTSSSEAFLIGVHYLGDFASGAVIDGNTMHANYIFWRNSTIMTMSYNSVLDLSKFNCKHKATVVVNLKDSSISDVVLGLLKNGKLLVRNNDAICGFSNHLVNVN
NAM  R1AB_CVH22/6459-6758
ASQ  SAEWKCGYSMPGIYKTQRMCLEPCNLYNYGAGLKLPSGIMFNVVKYTQLCQYFNSTTLCVPHNMRVLHLGAGSDYGVAPGTAVLKRWL..........PHDAIVVDNDVVDYVSDADFSVTGDCATVYLEDKFDLLISDMY----DGRTKAIDGENVSKEGFFTYI-NGFICEKLAIGGSIAIKVTEYSW-NKKLYELVQRFSFWTMFCTSVNTSSSEAFVVGINYLGDFAQGPFIDGNIIHANYVFWRNSTVMSLSYNSVLDLSKFNCKHKATVVVQLKDSDINEMVLSLVRSGKLLVRGNGKCLSFSNHLVSTK
DSQ  AGTGCAGAATGGAAATGCGGGTATTCTATGCCTGGTATTTATAAGACACAACGTATGTGCTTAGAACCATGTAATTTGTATAATTATGGTGCAGGTTTGAAGTTGCCCAGTGGCATTATGTTCAATGTTGTTAAATACACTCAATTGTGTCAATATTTTAACAGTACCACGTTATGTGTTCCTCATAATATGAGAGTGTTACACTTGGGTGCTGGCTCTGATTATGGTGTTGCACCAGGAACTGCTGTTCTTAAAAGGTGGTTG..............................CCGCACGACGCAATTGTTGTTGACAACGATGTTGTTGACTATGTGAGTGACGCTGATTTTAGTGTTACTGGTGATTGTGCAACCGTTTATTTGGAAGACAAGTTTGACTTGTTAATCTCTGATATGTAC------------GATGGTAGGACAAAGGCAATTGATGGTGAAAATGTTTCGAAAGAAGGATTTTTCACTTACATC---AATGGTTTCATTTGTGAAAAACTTGCCATCGGAGGTTCGATTGCTATTAAAGTAACAGAGTATAGCTGG---AATAAGAAATTGTATGAACTTGTACAAAGATTTTCTTTTTGGACTATGTTTTGCACTTCTGTTAATACGTCATCATCAGAAGCCTTTGTTGTCGGAATTAACTATCTTGGTGATTTCGCACAAGGACCTTTTATAGATGGTAACATAATACACGCAAATTATGTATTTTGGCGTAACTCCACTGTTATGAGTTTGTCCTACAACTCTGTTTTAGACCTGAGTAAATTTAATTGCAAACACAAAGCGACTGTTGTTGTGCAATTAAAGGATAGTGATATTAATGAAATGGTGCTTAGTCTTGTTAGGAGTGGTAAGTTGCTTGTAAGGGGTAATGGCAAGTGTTTGAGTTTTAGTAATCATTTAGTCTCAACTAAA
TRN  10010101100011000
NAM  R1AB_CVPFS/234-533
ASQ  SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCVPHKMRVLHLGAAGASGVAPGSTVLRRWL..........PDDAILVDNDLRDYVSDADFSVTGDCTSLYIEDKFDLLVSDLY----DGSTKSIDGENTSKDGFFTYI-NGFIKEKLSLGGSVAIKITEFSW-NKDLYELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMALSHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVNTP
DSQ  TCTGCCGAATGGAACCCCGGTTATAGCATGCCTACACTGTACAAAATCCAGCGTATGTGTCTCGAACGGTGTAATCTCTACAATTATGGTGCACAAGTGAAATTACCTGATGGCATTACTACTAATGTCGTTAAGTATACTCAGTTGTGTCAATACCTTAACACTACTACATTGTGTGTACCACACAAAATGCGTGTATTGCATTTAGGAGCTGCTGGTGCATCTGGTGTTGCTCCTGGTAGTACTGTATTAAGAAGATGGTTA..............................CCAGATGATGCCATATTGGTTGATAATGATTTGAGAGATTACGTTTCCGACGCAGACTTCAGTGTTACAGGTGATTGTACTAGTCTTTACATTGAAGATAAGTTTGATTTGCTCGTTTCTGATTTATAT------------GATGGCTCCACAAAATCAATTGACGGTGAAAACACGTCGAAAGATGGTTTCTTTACTTATATT---AATGGTTTCATTAAAGAGAAACTGTCACTTGGTGGATCTGTTGCCATTAAAATCACGGAATTTAGTTGG---AATAAAGATTTATATGAATTGATTCAAAGATTTGAGTATTGGACTGTGTTTTGTACAAGTGTTAACACGTCATCATCAGAAGGCTTTCTGATTGGTATTAACTACTTAGGACCATACTGTGACAAAGCAATAGTAGATGGAAATATAATGCATGCCAATTATATATTTTGGAGAAACTCTACAATTATGGCTCTATCACATAACTCAGTCCTAGACACTCCTAAATTCAAGTGTCGTTGTAACAACGCACTTATTGTTAATTTAAAAGAAAAAGAATTGAATGAAATGGTCATTGGATTACTAAGGAAGGGTAAGTTGCTCATTAGAAATAATGGTAAGTTACTAAACTTTGGTAACCACTTCGTTAACACACCA
TRN  10010101100011000
NAM  R1AB_CVHSA/6777-7073
ASQ  SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWL..........PTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMY----DPRTKHVTKENDSKEGFFTYL-CGFIKQKLALGGSIAVKITEHSW-NADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGK--PKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVN-N
DSQ  AGTCAAGCGTGGCAACCAGGTGTTGCGATGCCTAACTTGTACAAGATGCAAAGAATGCTTCTTGAAAAGTGTGACCTTCAGAATTATGGTGAAAATGCTGTTATACCAAAAGGAATAATGATGAATGTCGCAAAGTATACTCAACTGTGTCAATACTTAAATACACTTACTTTAGCTGTACCCTACAACATGAGAGTTATTCACTTTGGTGCTGGCTCTGATAAAGGAGTTGCACCAGGTACAGCTGTGCTCAGACAATGGTTG..............................CCAACTGGCACACTACTTGTCGATTCAGATCTTAATGACTTCGTCTCCGACGCAGATTCTACTTTAATTGGAGACTGTGCAACAGTACATACGGCTAATAAATGGGACCTTATTATTAGCGATATGTAT------------GACCCTAGGACCAAACATGTGACAAAAGAGAATGACTCTAAAGAAGGGTTTTTCACTTATCTG---TGTGGATTTATAAAGCAAAAACTAGCCCTGGGTGGTTCTATAGCTGTAAAGATAACAGAGCATTCTTGG---AATGCTGACCTTTACAAGCTTATGGGCCATTTCTCATGGTGGACAGCTTTTGTTACAAATGTAAATGCATCATCATCGGAAGCATTTTTAATTGGGGCTAACTATCTTGGCAAG------CCGAAGGAACAAATTGATGGCTATACCATGCATGCTAACTACATTTTCTGGAGGAACACAAATCCTATCCAGTTGTCTTCCTATTCACTCTTTGACATGAGCAAATTTCCTCTTAAATTAAGAGGAACTGCTGTAATGTCTCTTAAGGAGAATCAAATCAATGATATGATTTATTCTCTTCTGGAAAAAGGTAGGCTTATCATTAGAGAAAACAACAGAGTTGTGGTTTCAAGTGATATTCTTGTTAAC---AAC
TRN  10010101100011000
NAM  R1AB_CVBQ/6797-7054
ASQ  ASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLAVPVNTRVLHLGAGSEKGVAPGSAVLRQWLpagtilrqwlPAGTILVHNDLYPFVSDSVATYFGDCITLPFDCQWDLIISDMY---------DLLLDIGVHVVRCSYIHCHMIRDKLALGGSVAIKITEFSW-NAELYKLMGYFAFWTVFCTNANASSSEGFLIGINYLGK--PKVEIDGNVMHAIICF----GEI----------PQF-----GTGVLI-------------------------ACLIWLNSRLS--
NAM  R1AB_CVMA5/6879-7175
ASQ  AADWKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDKGVAPGSAVLRQWL..........PAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQWDLIISDMY----DPLTKNIGEYNVSKDGFFTYL-CHLIRDKLALGGSVAIKITEFSW-NAELYSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNK--TRTEIDGKTMHANYLFWRNSTMWNGGAYSLFDMSKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN-V
NAM  R1AB_IBVK/219-521
ASQ  QSAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGIMMNVAKYTQLCQYLSKTTVCVPHNMRVMHFGAGSDKGVAPGSTVLKQWL..........PEGTLLVDTDIVDYVSDAHVSVLSDCNKYKTEHKFDLVISDMYTDNDSKRKHGGVIANNGNDDVFIYL-SSFLRNNLALGGSFAVKLTETSW-HESLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGA-SVKVKVSGKTLHANYIFWRNCNYLQTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFVCTM
DSQ  CAATCAGCATGGACGTGTGGTTATAATATGCCTGAACTCTATAAAGTCCAGAATTGTGTTATGGAACCTTGCAACATTCCTAATTATGGTGTTGGAATAACGTTGCCAAGTGGTATTATGATGAATGTGGCAAAGTACACACAACTTTGTCAGTACCTTTCGAAAACAACAGTGTGTGTGCCGCATAATATGCGCGTTATGCATTTTGGAGCAGGTAGTGATAAAGGAGTGGCGCCTGGTAGTACTGTTCTTAAACAGTGGCTC..............................CCCGAAGGAACACTCCTTGTCGATACTGATATTGTAGATTATGTTTCTGACGCACACGTTTCTGTGCTTTCAGATTGCAATAAATATAAGACAGAGCACAAGTTTGATCTTGTGATATCTGATATGTATACAGACAATGATTCAAAAAGAAAGCATGGAGGCGTGATAGCCAATAATGGCAATGATGACGTCTTCATATACCTT---TCAAGTTTTCTACGCAATAATTTGGCTCTGGGAGGCAGTTTTGCTGTAAAATTAACAGAGACAAGTTGG---CATGAGAGTTTATATGACATTGCACAGGATTGTGCATGGTGGACAATGTTTTGTACAGCAGTGAATGCATCTTCTTCAGAAGCATTCCTGATTGGTGTTAATTACTTGGGTGCA---AGTGTAAAGGTTAAAGTTAGTGGAAAAACACTGCACGCAAATTATATATTTTGGAGGAATTGTAATTATTTACAAACCTCTGCTTATAGTATATTTGATGTTGCTAAGTTTGATTTGAGATTGAAAGCAACGCCAGTTGTTAATTTGAAAACTGAACAAAAGACAGACTTAGTCTTTAATTTAATTAAGTGTGGTAAGTTACTGGTAAGAGATGTTGGTAACACCTCTTTTACTAGTGACTCTTTTGTGTGCACTATG
TRN  10010101100011000
NAM  R1AB_BEV/2033-2271
ASQ  YYEW--------P-NILPQIESHYDLKNYGQNPTFMPQPV-NFAKYTQICTFIQD-HVKVARNALVWHLGAAGVDGCSPGDIVLSSFF..........-KECLVYSWDIKDY------STLLDKHSYDCNFRPNLIVSDIY-----------NVSSNVSEVLDDCV------HRLALGGTIVFKTTESSRPDIQLSQFTKYFSAVQFFTAGVNTSSSEVFVVLKYKLYSEPIGEELCSPNILSRIAAYRNKLCI-VPNFKVFSTS-FSYKYSGVKFVQ------------------------------KCFYVSVP
DSQ  TATTATGAGTGG------------------------CCA---AATATTTTACCACAAATTGAGTCCCATTATGACCTTAAAAATTATGGTCAAAATCCAACATTTATGCCGCAACCTGTG---AATTTTGCTAAATATACACAAATTTGTACCTTTATTCAAGAT---CATGTGAAGGTGGCACGAAATGCCTTGGTTTGGCATTTAGGTGCGGCTGGTGTTGATGGTTGTTCACCTGGTGATATTGTACTGTCTTCTTTTTTT..............................---AAAGAATGTTTAGTTTATAGTTGGGATATTAAGGATTAT------------------AGTACATTATTAGATAAGCATAGTTATGATTGTAATTTTAGGCCTAATTTAATAGTAAGTGATATATAT---------------------------------AATGTAAGTAGTAATGTAAGTGAAGTTTTGGATGATTGTGTG------------------CATCGACTTGCATTGGGAGGAACAATAGTTTTTAAAACAACTGAAAGTTCAAGACCAGATATACAATTAAGTCAGTTTACAAAATATTTTTCAGCTGTACAATTTTTTACAGCTGGTGTGAATACCTCCTCTTCGGAGGTTTTTGTCGTCTTGAAATATAAATTGTATTCCGAACCAATAGGTGAGGAATTGTGTTCTCCCAATATTTTAAGTCGTATTGCTGCTTATAGGAATAAGTTATGTATA---GTGCCTAATTTTAAAGTGTTTAGTACTAGT---TTTAGTTATAAGTATAGTGGTGTTAAGTTTGTGCAA------------------------------------------------------------------------------------------AAATGTTTTTATGTTTCTGTGCCG
TRN  10010101100011000
//