EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06453 - LT-IIB)
FAM  PF06453
PID  LT-IIB
DES  Type II heat-labile enterotoxin , B subunit (LT-IIB)
IPR  IPR010503
ANO  2
ALN  122
AID  0.580357
APH  (E2BB_ECOLI/1-122:0.32149,E2AB_ECOLI/1-122:0.24459);
ATP  (E2BB_ECOLI/1-122,E2AB_ECOLI/1-122);
ATL  0.56609
DNO  2
DLN  366
DID  0.663934
DPH  (E2BB_ECOLI/1-122:0.10367,E2AB_ECOLI/1-122:0.35795);
DTP  (E2BB_ECOLI/1-122,E2AB_ECOLI/1-122);
DTL  0.46162
RID  0.580357
RPH  (E2BB_ECOLI/1-122:0.32149,E2AB_ECOLI/1-122:0.24459);
RTP  (E2BB_ECOLI/1-122,E2AB_ECOLI/1-122);
RTL  0.56609
LNK  E2AB_ECOLI/1-122:P13812:M17894
LNK  E2BB_ECOLI/1-122:P43529:M28523
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  E2BB_ECOLI/1-122
ASQ  MSFKKIIKAFVIMAALVSVQAHAGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAE
DSQ  ATGAGCTTTAAGAAAATTATCAAGGCATTTGTTATCATGGCTGCTTTGGTATCTGTTCAGGCACATGCAGGTGCCAGTCAGTTTTTTAAAGATAACTGTAACAGAACCACAGCATCTCTTGTGGAAGGTGTTGAGCTAACAAAATACATTTCTGACATTAATAATAACACCGATGGAATGTACGTTGTAAGTTCTACTGGAGGTGTTTGGCGTATTTCTAGGGCTAAAGACTATCCAGACAATGTTATGACTGCTGAAATGAGGAAGATTGCGATGGCGGCTGTGTTGTCTGGTATGAGAGTAAATATGTGTGCCAGCCCAGCTAGCAGTCCCAATGTTATTTGGGCCATCGAGTTAGAGGCAGAA
TRN  10010101110011010
NAM  E2AB_ECOLI/1-122
ASQ  MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE
DSQ  ATGAGCTCTAAGAAAATAATTGGTGCTTTTGTTCTGATGACTGGCATTCTGTCTGGTCAGGTATATGCTGGTGTAAGTGAACACTTCAGGAATATTTGTAATCAAACCACTGCAGATATTGTGGCAGGAGTGCAACTGAAGAAATATATTGCTGATGTAAACACAAATACTCGTGGGATCTATGTGGTAAGTAATACTGGAGGTGTTTGGTATATTCCGGGTGGACGGGATTATCCGGATAATTTCTTAAGTGGAGAAATCAGAAAAACTGCAATGGCGGCCATTCTCTCAGATACGAAAGTTAATTTGTGCGCAAAAACATCTTCAAGTCCAAATCACATTTGGGCTATGGAATTAGATAGAGAG
TRN  10010101100011000
//