EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06433 - Me-amine-dh_H)
FAM  PF06433
PID  Me-amine-dh_H
DES  Methylamine dehydrogenase heavy chain (MADH)
IPR  IPR009451
ANO  5
ALN  343
AID  0.61085
APH  (((DHMH_PARVE/83-423:0.16631,DHMH_PARDE/74-415:0.12485):0.11301,DHMH_METEX/69-410:0.16500):0.41823,DHMH_METFL/59-400:0.22849,DHMH_METME/64-404:0.17131);
ATP  (((DHMH_PARVE/83-423,DHMH_PARDE/74-415),DHMH_METEX/69-410),DHMH_METFL/59-400,DHMH_METME/64-404);
ATL  1.38721
DNO  5
DLN  1029
DID  0.638146
DPH  (((DHMH_PARVE/83-423:0.12597,DHMH_PARDE/74-415:0.10486):0.09136,DHMH_METEX/69-410:0.14727):0.29895,DHMH_METFL/59-400:0.22082,DHMH_METME/64-404:0.20196);
DTP  (((DHMH_PARVE/83-423,DHMH_PARDE/74-415),DHMH_METEX/69-410),DHMH_METFL/59-400,DHMH_METME/64-404);
DTL  1.19119
RID  0.61085
RPH  (((DHMH_PARVE/83-423:0.16631,DHMH_PARDE/74-415:0.12485):0.11301,DHMH_METEX/69-410:0.16500):0.41823,DHMH_METFL/59-400:0.22849,DHMH_METME/64-404:0.17131);
RTP  (((DHMH_PARVE/83-423,DHMH_PARDE/74-415),DHMH_METEX/69-410),DHMH_METFL/59-400,DHMH_METME/64-404);
RTL  1.38721
LNK  DHMH_METEX/69-410:Q49124:L26406
LNK  DHMH_METFL/59-400:Q50420:AF188997
LNK  DHMH_METME/64-404:Q59542:L26407
LNK  DHMH_PARDE/74-415:P29894:M90099
LNK  DHMH_PARVE/83-423:P23006:L08575
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  DHMH_METME/64-404
ASQ  DSKRVYVLDPGNFHMTSTVYTIDGKSSKLLGMTDAGKLPNVMVASDGKFLAIANTMYSRVARGKRDDYLELIDTKTHQPIADIDIPEG-RFLTGVFERTAGLSVDDKHLLFQQFSPSPGVGLVDLQQKAFVKIMNVPDCYHIFPTANQNFFMHCRDGSLMQFTYDSKGNTK-QKPTKIFHAEKEYLLNNPYYSNSNNHLTWPTYEGKIFQAKLSESGAEFLKPIEVFTDKEKADKWRPGGWQTIAFHKARNELYLLADQREKWTHKLPSRFVFVVDATSGKRLRRIELKHEINSIAVSQDDKPYLYAVSEEAKTLFTFDAVNGKALSSIDELGRAPSMIFIAD
DSQ  GACTCCAAGCGCGTCTATGTGCTGGATCCAGGTAACTTTCATATGACCTCTACCGTCTATACGATAGATGGCAAATCAAGCAAATTACTGGGCATGACCGATGCCGGTAAATTGCCTAACGTCATGGTAGCGTCAGATGGCAAGTTTTTGGCCATCGCCAACACCATGTACTCCCGCGTGGCCCGTGGCAAACGTGATGACTACCTGGAGTTGATCGACACCAAAACGCATCAACCCATTGCCGATATCGATATTCCTGAAGGT---CGTTTTTTGACCGGTGTGTTTGAGCGTACGGCGGGGTTGAGTGTGGATGACAAGCACTTGTTGTTCCAGCAATTCTCACCGTCACCAGGCGTAGGCTTGGTCGATCTGCAACAAAAGGCTTTCGTGAAAATCATGAACGTGCCTGATTGTTACCATATTTTCCCAACGGCTAACCAGAACTTCTTCATGCACTGTAGAGACGGTTCTTTGATGCAGTTCACCTATGACAGCAAGGGCAACACCAAG---CAGAAGCCCACCAAGATATTCCATGCCGAAAAAGAGTATCTGCTGAATAACCCTTATTACTCAAACTCCAATAATCACCTGACCTGGCCGACCTATGAAGGCAAGATTTTTCAGGCGAAATTATCTGAGAGCGGCGCCGAGTTCCTCAAGCCTATCGAAGTGTTCACCGACAAGGAGAAAGCCGACAAATGGCGTCCGGGTGGCTGGCAGACCATTGCCTTCCACAAAGCGCGTAACGAGCTCTATTTGCTAGCAGACCAACGTGAAAAATGGACACACAAATTGCCTAGCCGTTTTGTGTTTGTGGTGGATGCGACCTCTGGCAAACGCCTGCGCCGTATCGAGTTGAAGCATGAAATCAACTCTATCGCCGTCAGCCAGGACGACAAGCCGTACTTGTACGCCGTGTCTGAAGAAGCCAAAACACTGTTCACTTTTGATGCTGTGAACGGCAAGGCTTTGTCCAGTATTGATGAACTGGGCCGTGCACCTTCCATGATTTTCATTGCGGAT
TRN  10010101100011000
NAM  DHMH_METFL/59-400
ASQ  DAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVMLSSDGKFFVTSNTTYSRIARGKRDDYVEVIDAQSHKVLADIDIPEG-RFLTGVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIFPVPNQSFYMHCRDGSLQQFGYDDKGNLKPMKPTKVFHGEDDYLFVNPYYSNGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEAEKKANWRPGGWQVVAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEIDGISVTQDANPNLYAVSAEAKTLFTFNAVTGKETGKVDELGRAPTISLTMD
DSQ  GATGCCAAGCGTGTGTATGTGCTGGATCCCGGTCACTTCCATGTGACGACGACGGTCTACACCATTGATGGCAACAAGAACAACCTGCTGGGGATGACCGATACCGGCAAGCTGGCCAACGTGATGCTGAGCAGCGATGGTAAGTTCTTCGTGACCTCGAATACCACCTATAGTCGCATTGCCCGCGGCAAGCGCGATGACTATGTCGAGGTGATTGATGCGCAAAGCCATAAGGTGCTGGCCGATATTGACATTCCTGAAGGT---CGGTTCCTCACGGGCGTGATGAATCGCATGGCATCTCTTTCCACCGATAATAAGTACATGCTGTTCCAGCAGTTTGCGCCGTCTCCTGCCGTTGGTCTGGTTGATCTGGAGAAGAAGAGCTTCGTCAAGATGATGGATATACCTGATTGCTACCAGATTTTCCCTGTGCCCAATCAGAGTTTCTATATGCACTGTCGTGATGGTTCCTTGCAACAGTTCGGCTATGACGATAAAGGTAATCTCAAGCCAATGAAGCCTACCAAGGTGTTTCATGGCGAAGATGATTATCTGTTCGTGAATCCTTATTACTCCAACGGTTCTGGTCGGCTAGTATGGCCCACTTATGAAGGCCGCATATTTCAGGCTAAGTTGACGGATAAGAAAGTCGATTTCATGAAGCCTTTCGAATTGTTCACTGAAGCGGAAAAGAAAGCTAATTGGCGGCCGGGGGGCTGGCAGGTGGTGGCATATCACAAGGCAAGAAATGAAATCTATGTGTTGGCAGATCAACGTGCCAAATGGACGCATGTGACTGCAAGCCGTTATGTGTTCGTTGTCGACGGCACCACCGGCAAGCGCCTGCGCCGCATCGACCTCGGCCACGAGATTGACGGCATCAGCGTCACCCAGGATGCCAACCCCAATCTCTATGCGGTGTCTGCCGAAGCCAAGACCCTGTTTACCTTCAATGCGGTGACCGGCAAGGAAACCGGCAAGGTGGACGAGCTTGGCCGCGCGCCAACCATTTCTCTGACAATGGAT
TRN  10010101100011011
NAM  DHMH_PARDE/74-415
ASQ  DARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRLLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTAD
DSQ  GACGCGCGCCGCGTCTATGTCAACGACCCGGCGCATTTCGCCGCGGTCACCCAGCAATTCGTCATCGACGGCGAGGCGGGCCGGGTGATCGGCATGATCGACGGCGGCTTCCTGCCCAATCCGGTGGTGGCCGACGACGGCTCGTTCATCGCCCATGCCAGCACGGTGTTTTCCCGCATCGCACGGGGCGAGCGGACGGATTACGTCGAGGTCTTCGACCCCGTGACGCTGCTGCCCACGGCGGATATCGAGCTGCCGGATGCGCCGCGCTTCCTGGTCGGCACCTATCCCTGGATGACCTCGCTGACGCCGGACGGCAAGACGCTGCTGTTCTATCAGTTCTCGCCCGCTCCGGCCGTCGGCGTGGTCGATCTGGAGGGCAAGGCGTTCAAGCGCATGCTGGACGTGCCGGATTGCTATCACATCTTCCCGACCGCGCCCGACACCTTCTTCATGCATTGCCGCGACGGCAGCCTCGCCAAGGTGGCATTCGGCACCGAGGGCACGCCCGAG---ATCACCCATACCGAGGTGTTCCACCCCGAGGACGAGTTCCTCATCAACCACCCCGCCTATTCGCAAAAGGCCGGGCGGCTGGTCTGGCCGACCTATACCGGCAAGATCCATCAGATCGACCTGTCCTCGGGGGATGCGAAGTTCCTGCCCGCCGTCGAGGCGCTGACCGAGGCAGAGCGCGCCGATGGCTGGCGTCCCGGCGGCTGGCAGCAGGTCGCCTATCACCGCGCGCTGGACCGCATCTATCTGCTGGTCGATCAGCGCGACGAATGGCGCCACAAGACCGCCAGCCGCTTGCTGGTGGTGCTGGATGCCAAGACCGGCGAGCGGCTGGCCAAGTTCGAAATGGGCCACGAGATCGACTCGATCAATGTCAGCCAGGACGAAAAGCCGCTGCTCTACGCGCTCTCGACCGGGGACAAGACGCTTTACATCCATGACGCCGAAAGCGGCGAGGAATTGCGCAGCGTGAACCAGCTGGGCCACGGCCCGCAGGTCATCACCACGGCGGAC
TRN  11011111101111111
NAM  DHMH_PARVE/83-423
ASQ  DARRVYIQDPAHFAAITQQFVIDGSTGRILGMTDGGFLPHPVAAEDGSFFAQASTVFERIARGKRTDYVEVFDPVTFLPIADIELPDAPRFLVGTYQWMNALTPDNKNLLFYQFSPAPAVGVVDLEGKTFDRMLDVPDCYHIFPASPTVFYMNCRDGSLARVDFA-DGETK-VTNTEVFHTEDELLINHPAFSLRSGRLVWPTYTGKIFQADLTAEGATFRAPIEALTEAERADDWRPGGWQQTAYHRQSDRIYLLVDQRDEWKHKAASRFVVVLNAETGERINKIELGHEIDSINVSQDAEPLLYALSAGTQTLHIYDAATGEELRSVDQLGRGPQIITTHD
DSQ  GATGCGAGGCGGGTCTATATCCAGGATCCGGCGCATTTCGCCGCCATCACCCAGCAATTCGTCATCGACGGCTCGACCGGGCGGATCCTGGGCATGACCGACGGCGGCTTCCTGCCGCATCCGGTCGCGGCCGAGGACGGCTCGTTCTTCGCCCAGGCCAGCACCGTCTTCGAGCGTATCGCGCGCGGCAAGCGCACCGATTACGTCGAGGTGTTCGACCCCGTCACCTTCCTGCCCATCGCCGACATCGAGCTGCCCGACGCGCCGCGCTTCCTGGTGGGCACCTACCAATGGATGAACGCGCTGACGCCGGACAACAAGAACCTGCTGTTCTACCAGTTCTCGCCCGCGCCGGCGGTCGGCGTGGTCGACCTGGAGGGCAAGACGTTCGACCGCATGCTGGACGTGCCGGACTGCTATCACATCTTCCCGGCATCGCCGACGGTCTTCTACATGAACTGCCGGGACGGCAGCCTGGCCCGCGTGGATTTCGCC---GATGGCGAGACCAAG---GTGACGAACACCGAGGTTTTCCATACCGAGGATGAGTTGCTCATCAACCATCCCGCCTTCTCGCTGCGCTCGGGCAGGCTGGTCTGGCCGACCTATACCGGCAAGATCTTCCAGGCCGACCTGACCGCCGAGGGCGCCACCTTCCGCGCGCCGATCGAGGCCCTGACCGAGGCGGAGCGCGCCGACGACTGGCGGCCCGGCGGCTGGCAGCAGACCGCCTATCACCGCCAGTCGGACCGCATCTACCTGCTGGTGGACCAGCGCGACGAATGGAAGCACAAGGCCGCCAGCCGCTTCGTCGTGGTGCTGAACGCCGAGACCGGCGAGCGGATCAACAAGATCGAGCTGGGCCACGAGATCGACTCGATCAACGTCAGCCAGGATGCGGAGCCCCTGCTTTACGCGCTGTCGGCGGGCACTCAGACGCTGCACATCTACGACGCGGCGACCGGCGAGGAACTGCGCAGCGTCGACCAGCTTGGCCGCGGCCCGCAGATCATCACCACCCATGAC
TRN  10010101100011011
NAM  DHMH_METEX/69-410
ASQ  NARRVFVYDPKHFAAISQFYMIDGDTARVVGTADGGFLSNPVVASDGSFFGQASTVYERIARGKRTDYVELLDPQTNNPIADIELPNSPRFLVGTYPWMTALTPNNKTLLFYQFSPQPAVGVVDLAGKKFDRMIEVPDCYHIFPSSNDTFFMHCRDGSLLKVGIGADGKSQ-TKRTEIFHKENEYLINHPAYSPKSGRLVWPTYTGKIFQIDLSSQDAKFLPAIEAFTDAEKKEGWAPGGWQQVAYHRESDRIFLLGDQRAASKHKAPSRFLFVIDAKTGKRINKIELKHEIDSVGVSQDAKPQLYALSTGDKALYIFDPETGKEVSSVNQLGAGPQVVMTSD
DSQ  AACGCCCGCCGTGTCTTCGTCTACGACCCGAAGCACTTCGCCGCCATTTCGCAGTTCTACATGATCGATGGCGACACGGCCCGCGTCGTTGGCACGGCGGATGGCGGCTTTTTGTCGAACCCGGTGGTAGCCAGCGACGGCTCCTTCTTCGGACAGGCCAGCACGGTGTACGAGCGGATCGCCCGCGGCAAGCGCACCGACTATGTCGAATTGCTCGACCCACAGACCAACAACCCGATCGCGGACATCGAACTGCCGAACTCGCCGCGCTTCCTCGTCGGAACCTATCCGTGGATGACGGCGCTGACGCCCAACAACAAGACGCTGCTCTTCTACCAGTTCTCGCCCCAGCCTGCCGTCGGTGTCGTCGACCTCGCCGGCAAGAAGTTCGATCGGATGATCGAGGTGCCGGACTGCTATCATATCTTCCCATCCAGCAATGACACCTTCTTCATGCATTGCCGTGACGGCAGCCTCTTGAAGGTGGGCATCGGCGCCGATGGAAAGTCTCAG---ACGAAGCGAACTGAGATCTTCCATAAGGAAAACGAGTACCTCATCAACCATCCGGCCTACTCGCCTAAGAGCGGCCGCCTCGTGTGGCCAACCTACACGGGCAAGATCTTCCAGATCGACCTCTCCTCGCAGGACGCCAAGTTCCTCCCGGCGATCGAGGCGTTCACCGACGCCGAGAAGAAGGAGGGCTGGGCGCCGGGCGGCTGGCAGCAGGTCGCCTACCACCGTGAGAGCGACCGCATCTTCCTGCTCGGTGACCAGCGCGCGGCCTCCAAGCACAAGGCGCCGAGCCGCTTCCTGTTCGTGATCGATGCCAAGACCGGCAAGCGCATCAACAAGATCGAACTCAAGCATGAGATCGACTCGGTCGGTGTGAGCCAGGATGCCAAGCCGCAGCTCTACGCGCTCTCGACCGGTGACAAGGCGCTGTACATCTTCGATCCCGAGACCGGCAAGGAAGTGTCGAGCGTCAATCAGCTCGGCGCCGGGCCGCAGGTCGTCATGACCTCGGAC
TRN  11011111101111111
//