EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06414 - Zeta_toxin)
FAM  PF06414
PID  Zeta_toxin
DES  Zeta toxin
IPR  IPR010488
ANO  9
ALN  230
AID  0.266698
APH  (((((Q99Q13_STRCO/3-229:0.65360,Q99Q13_STRCO/299-525:0.83809):0.52779,(Q9XAX4_PSEAC/34-260:0.52158,(Q8PRH5_XANAC/8-233:0.59111,Q8P580_XANCP/24-239:0.96836):0.12218):0.26137):0.36871,Q8DTS0_STRMU/6-196:1.34347):0.27183,ZTOX_STRPY/6-226:0.48134):0.40719,Q8E4Q8_STRA3/6-225:0.19389,Q8DPX8_STRR6/6-225:0.11529);
ATP  (((((Q99Q13_STRCO/3-229,Q99Q13_STRCO/299-525),(Q9XAX4_PSEAC/34-260,(Q8PRH5_XANAC/8-233,Q8P580_XANCP/24-239))),Q8DTS0_STRMU/6-196),ZTOX_STRPY/6-226),Q8E4Q8_STRA3/6-225,Q8DPX8_STRR6/6-225);
ATL  7.68357
DNO  9
DLN  690
DID  0.388324
DPH  (Q9XAX4_PSEAC/34-260:0.42538,((Q99Q13_STRCO/3-229:0.39549,Q99Q13_STRCO/299-525:0.50547):0.35235,Q8PRH5_XANAC/8-233:0.34280):0.11245,((Q8DTS0_STRMU/6-196:0.88257,(ZTOX_STRPY/6-226:0.42026,(Q8E4Q8_STRA3/6-225:0.23549,Q8DPX8_STRR6/6-225:0.19739):0.22428):0.14014):0.46130,Q8P580_XANCP/24-239:0.47434):0.14104);
DTP  (Q9XAX4_PSEAC/34-260,((Q99Q13_STRCO/3-229,Q99Q13_STRCO/299-525),Q8PRH5_XANAC/8-233),((Q8DTS0_STRMU/6-196,(ZTOX_STRPY/6-226,(Q8E4Q8_STRA3/6-225,Q8DPX8_STRR6/6-225))),Q8P580_XANCP/24-239));
DTL  5.31074
RID  0.266698
RPH  (((((Q99Q13_STRCO/3-229:0.65360,Q99Q13_STRCO/299-525:0.83809):0.52779,(Q9XAX4_PSEAC/34-260:0.52158,(Q8PRH5_XANAC/8-233:0.59111,Q8P580_XANCP/24-239:0.96836):0.12218):0.26137):0.36871,Q8DTS0_STRMU/6-196:1.34347):0.27183,ZTOX_STRPY/6-226:0.48134):0.40719,Q8E4Q8_STRA3/6-225:0.19389,Q8DPX8_STRR6/6-225:0.11529);
RTP  (((((Q99Q13_STRCO/3-229,Q99Q13_STRCO/299-525),(Q9XAX4_PSEAC/34-260,(Q8PRH5_XANAC/8-233,Q8P580_XANCP/24-239))),Q8DTS0_STRMU/6-196),ZTOX_STRPY/6-226),Q8E4Q8_STRA3/6-225,Q8DPX8_STRR6/6-225);
RTL  7.68357
LNK  Q8DPX8_STRR6/6-225:Q8DPX8:AE008467
LNK  Q8DTS0_STRMU/6-196:Q8DTS0:AE014961
LNK  Q8E4Q8_STRA3/6-225:Q8E4Q8:AL766850
LNK  Q8P580_XANCP/24-239:Q8P580:AE012465
LNK  Q8PRH5_XANAC/8-233:Q8PRH5:AE008925
LNK  Q99Q13_STRCO/299-525:Q99Q13:AL590464
LNK  Q99Q13_STRCO/3-229:Q99Q13:AL590464
LNK  Q9XAX4_PSEAC/34-260:Q9XAX4:U88088
LNK  ZTOX_STRPY/6-226:Q54944:X64695
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9XAX4_PSEAC/34-260
ASQ  LEQARHEKIYSQ-ISADYLSHVEAQESPRAIITGGQPGSGKGALARQAENAFAASGSCVSIDVDELRDYHPQYKELQRVNDREAANLVHPDASAWASQLIRDAAAARKNIVIDQTSKSPDALIDLTKQLKAAGYNIELRVMAVNSEISEQRIHTRYEKDKADNK-LARFVPPEVHFAGYIGLPESVAAVEREKAVDGLSIHDSNQVSIYEIKQI-DGEWDRQPEGKAVLE
DSQ  CTGGAGCAGGCGAGACACGAAAAAATCTATTCGCAA---ATTTCTGCTGACTACTTGTCGCATGTGGAGGCCCAGGAAAGCCCGCGAGCGATTATCACGGGTGGCCAGCCCGGATCAGGAAAGGGGGCGCTAGCCAGACAGGCGGAAAATGCGTTTGCAGCGTCTGGGTCTTGCGTTTCGATTGACGTTGATGAACTTCGTGACTATCACCCGCAGTACAAAGAACTGCAGCGCGTAAACGACCGAGAGGCGGCAAACCTTGTGCACCCTGATGCCTCGGCTTGGGCCAGCCAGCTTATAAGGGACGCCGCAGCCGCTCGAAAAAACATTGTCATTGACCAAACCTCAAAAAGCCCCGATGCACTCATTGACCTGACCAAGCAGCTTAAAGCCGCTGGATACAACATCGAGCTAAGAGTGATGGCGGTCAATTCCGAGATTAGCGAGCAACGCATTCACACCAGGTACGAGAAAGACAAGGCCGATAATAAG---CTGGCCCGCTTTGTACCCCCGGAAGTCCACTTTGCGGGTTATATCGGATTGCCCGAAAGCGTGGCCGCTGTAGAGCGTGAAAAAGCCGTGGACGGGTTGAGCATCCACGACAGTAACCAGGTCAGCATTTACGAAATCAAGCAGATT---GACGGCGAGTGGGATAGGCAGCCAGAAGGCAAAGCCGTACTGGAA
TRN  10010101100011001
NAM  Q8PRH5_XANAC/8-233
ASQ  LSTRKHTAAYEK-IERHHFKDTAPADQPQAIILGGQPGAGKSGLLEASKQGF-ADRNVVTINGDELRYYHPQYRDIQKADERRFAELTDPHARPWTKQLFDRTIETRRNVVFEGTMREAGPITETMRRLKEAGYYVVARVIAANERDSMAGIHRRYEEQKAAK-GFGRWSNVQAHDDAYKGMPATLEYIEHNKLADRVQVYDRKGNVLYDNELQ-GNEWKRQPAAKTAIE
DSQ  CTGAGCACACGCAAGCACACGGCCGCTTACGAGAAA---ATCGAGCGGCATCACTTCAAGGACACTGCGCCGGCCGACCAACCGCAGGCAATCATCTTGGGCGGCCAGCCCGGCGCAGGCAAAAGCGGGTTGCTCGAAGCCAGCAAACAGGGCTTT---GCAGATCGCAACGTTGTCACGATCAACGGCGACGAGCTGCGCTACTACCACCCTCAATACCGAGACATTCAGAAGGCCGACGAGCGCCGGTTTGCCGAGCTGACCGACCCGCACGCCCGGCCGTGGACCAAGCAGCTATTCGACCGCACCATCGAGACACGTCGCAACGTCGTGTTTGAAGGCACGATGCGCGAAGCCGGTCCTATCACCGAGACGATGCGACGCCTCAAAGAAGCCGGCTATTACGTCGTCGCCCGCGTAATCGCGGCCAACGAACGCGACAGCATGGCCGGCATCCACCGCCGCTATGAAGAACAGAAGGCGGCCAAG---GGCTTCGGCCGCTGGTCGAATGTGCAGGCTCATGACGACGCCTACAAAGGGATGCCGGCGACGCTCGAATACATCGAGCACAACAAACTGGCTGACCGCGTGCAGGTCTACGACCGTAAGGGCAACGTGCTGTACGACAACGAGCTGCAG---GGCAACGAATGGAAACGGCAGCCGGCAGCAAAGACCGCCATCGAG
TRN  11011101101011011
NAM  Q8P580_XANCP/24-239
ASQ  EHRRLFEQKILD-DAA--LETKTSFEHPKAIILAGQPGSGKGSLARAADVEL--GRDVVLIDPDELRNAHPEVSALRNAHPYTWSGYTHSDASQWADELLQVTIEGKKNLIFDTTLSNGQWSAELIKDLQSRGYDVEVRAMAAHKLESEHGVDSRFSQQ-LDREGYGRYVPESHREVVYTRLPISLDTVHAQTT-APVRIFNRQGAEVYDSRTD-------ARPPGQALE
DSQ  GAGCATCGCAGATTATTTGAGCAGAAGATTCTTGAT---GATGCCGCA------CTGGAGACAAAAACGTCCTTCGAACACCCCAAGGCGATCATCCTCGCTGGGCAACCTGGCTCGGGAAAAGGAAGTCTCGCAAGAGCTGCAGACGTCGAGCTA------GGCAGGGATGTCGTCCTGATCGATCCGGATGAATTGCGTAACGCTCACCCCGAAGTGTCCGCCCTGCGCAATGCCCACCCCTACACCTGGTCTGGCTACACCCACTCCGATGCCAGCCAATGGGCCGATGAACTGCTGCAAGTCACTATCGAAGGCAAGAAGAACCTGATCTTCGACACCACGCTCAGCAATGGCCAGTGGAGCGCGGAACTGATCAAGGATCTGCAATCGCGCGGCTATGACGTCGAGGTGCGTGCAATGGCCGCGCACAAGCTGGAAAGCGAGCATGGCGTCGATTCCAGGTTTTCTCAGCAG---CTCGATCGGGAAGGCTACGGCCGCTACGTGCCCGAAAGTCATCGCGAGGTCGTCTACACCAGGCTGCCGATCAGCCTGGACACGGTGCATGCCCAGACCACG---GCGCCCGTACGCATCTTCAACCGCCAGGGTGCCGAGGTTTACGATAGCCGCACCGAT---------------------GCACGTCCGCCCGGGCAGGCACTGGAA
TRN  10010101100011010
NAM  Q8DPX8_STRR6/6-225
ASQ  YTDSEFKHALAR-NLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEF--QGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTIDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQARATPKEHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKEN-------TTSAADVLQ
DSQ  TATACTGATAGTGAATTCAAACATGCTTTAGCAAGG---AATCTTCGTTCACTGACAAGAGGAAAAAAGTCCAGTAAACAACCTATAGCGATTTTGCTTGGAGGGCAAAGTGGTGCCGGTAAGACTACAATTCATCGTATTAAACAGAAAGAATTT------CAAGGAAATATTGTTATCATAGATGGCGATAGTTTTCGTTCTCAGCATCCACACTATTTAGAACTGCAGCAAGAATATGGCAAAGATAGCGTTGAATACACCAAAGATTTTGCAGGAAAAATGGTAGAGTCTTTAGTAACAAAATTGAGTAGTTTGGGATACAATCTTTTGATCGAGGGAACTTTACGAACAATTGATGTTCCAAAGAAAACGGCACAACTCTTGAAAAATAAGGGATATGAAGTACAATTGGCCTTAATTGCGACAAAGCCTGAATTGTCGTATCTAAGTACTCTTATCCGTTATGAAGAACTGTACATTATCAATCCAAATCAAGCACGCGCAACTCCAAAAGAACATCATGATTTCATTGTAAATCATCTAGTTGATAACACACGAAAATTGGAAGAACTAGCTATCTTTGAAAGAATTCAAATTTACCAACGAGATAGAAGTTGTGTATATGATTCAAAAGAAAAT---------------------ACAACTTCAGCAGCAGATGTTCTTCAA
TRN  10010101100011000
NAM  Q8E4Q8_STRA3/6-225
ASQ  YSEAEFQKALRR-NIRALTRGKTISSTPKAVLLGGQSGAGKTTIHRIKQKEF--QGNIIIIDGDSFRSQHPNYLALQEEYGKYSVDYTKDFAGKMVEHLIGGLSKQSYHLLIEGTLRTTEVPRKTAQLLKSRGYQVSLALIATKPELSYLSTLIRYEELYAIDPNQARATPKEYHDGIVEHLVDNLRELENDKLFNRIQIYQRDRHCVYDSETD-------KGIAAEVLQ
DSQ  TATAGTGAGGCGGAGTTTCAAAAGGCTTTAAGGCGT---AATATTCGTGCTTTAACCCGTGGCAAAACTATTTCCTCAACTCCCAAAGCAGTTCTGCTTGGTGGTCAAAGTGGAGCTGGAAAAACGACCATTCATCGAATCAAGCAAAAGGAATTT------CAAGGGAATATCATCATTATTGACGGAGATAGCTTCCGTTCGCAGCATCCAAATTATCTGGCTTTGCAGGAAGAGTATGGCAAATATAGCGTTGATTATACCAAAGATTTTGCGGGGAAGATGGTTGAACACCTCATTGGTGGACTCAGCAAACAAAGCTATCATTTATTAATTGAGGGAACACTGAGAACAACAGAAGTCCCTCGAAAAACAGCTCAATTATTAAAATCAAGAGGCTATCAAGTATCACTTGCGCTCATCGCAACAAAGCCAGAACTGTCCTATCTTAGCACCTTGATACGCTATGAAGAACTTTATGCCATAGATCCTAATCAAGCCAGAGCAACACCAAAAGAATATCATGATGGGATTGTGGAACACTTGGTTGATAATCTACGAGAGTTAGAAAATGATAAACTTTTTAACCGGATTCAAATCTATCAAAGAGATAGACATTGTGTCTATGATTCTGAAACTGAT---------------------AAAGGCATAGCTGCAGAAGTGCTTCAA
TRN  10010101100011000
NAM  ZTOX_STRPY/6-226
ASQ  FTDKQFENRLND-NLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEET--QGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLET------PSISPKETLE
DSQ  TTTACTGACAAACAATTTGAGAATCGCTTAAATGAT---AATTTAGAAGAATTGATTCAAGGAAAAAAAGCGGTTGAATCGCCAACCGCTTTTTTACTTGGTGGGCAACCAGGGTCAGGGAAAACCAGTTTGCGATCAGCAATTTTTGAAGAAACA------CAAGGGAATGTTATTGTCATTGATAATGATACCTTTAAACAACAGCACCCTAATTTTGATGAACTAGTGAAACTTTATGAAAAAGACGTAGTAAAACACGTTACCCCTTATTCTAATCGCATGACAGAAGCGATCATAAGCCGTTTGAGCGATCAAGGGTATAATTTGGTGATCGAAGGTACAGGACGAACAACAGACGTTCCTATTCAAACCGCAACAATGCTTCAAGCCAAAGGTTATGAAACAAAAATGTATGTCATGGCAGTACCTAAAATCAACTCATATTTAGGAACAATTGAACGATATGAAACCATGTATGCAGATGATCCAATGACAGCCAGGGCAACACCAAAACAAGCGCATGATATTGTTGTCAAAAACTTACCGACCAATTTAGAAACCCTTCATAAAACGGGCTTATTTAGCGATATAAGGCTATATAACAGAGAAGGAGTAAAACTCTATTCAAGTTTGGAAACA------------------CCTTCTATTAGTCCAAAAGAAACCTTAGAA
TRN  10010101110011000
NAM  Q99Q13_STRCO/299-525
ASQ  LSASEHRWIFDELIVPSYLGGLVGRDDPRAVYVLGQPGAGKLLAARMVRRAM--RPGTTRLVGDDFKASHPDYFQLLRDDPRSAGQAIRADYRAWFAQAEEYVRRRGGDVLIEAAPGSVDEFLSSALPFAASGYPVELVVLAVREADSRLATALRYARA-LQRGGTGRFTTRAGHDACFRALTDVVAVAERHPQITAVTVIRRDGQALMRSEAGGDGGRASRALAAERLR
DSQ  CTCTCCGCCAGCGAGCACCGCTGGATTTTCGACGAGCTGATCGTCCCGTCCTATCTGGGCGGTCTCGTCGGCCGGGACGATCCGCGGGCGGTGTACGTGCTGGGCCAGCCCGGAGCAGGGAAGTTGCTGGCAGCCAGGATGGTCAGGCGTGCGATG------CGGCCGGGCACGACCCGGCTGGTCGGCGACGACTTCAAGGCCTCGCATCCTGACTACTTCCAGCTGCTGCGTGACGATCCCCGCAGCGCCGGGCAAGCGATCCGCGCCGATTACCGGGCCTGGTTCGCTCAGGCCGAGGAGTACGTGCGCCGGCGGGGAGGAGATGTCCTGATCGAGGCGGCCCCGGGCAGCGTGGATGAGTTCCTCTCCAGTGCGCTGCCTTTCGCGGCCAGTGGCTATCCGGTCGAGCTGGTCGTCCTGGCCGTCCGTGAAGCCGACAGCCGTCTCGCCACCGCGCTGCGCTATGCCCGTGCG---CTGCAGCGCGGCGGCACCGGGCGGTTCACCACCCGCGCCGGGCATGACGCGTGCTTCCGCGCGCTCACCGACGTAGTCGCTGTCGCCGAGCGGCACCCTCAGATCACGGCGGTCACCGTGATCCGGCGGGACGGTCAGGCCCTGATGCGCAGTGAGGCCGGCGGCGACGGTGGCCGAGCCTCGCGGGCGCTGGCCGCCGAGCGGCTCCGT
TRN  10010101100011011
NAM  Q99Q13_STRCO/3-229
ASQ  SQQESLDVLHRT-ILPAALQSAVPQTRPVVVVVAGQPGAGKTAAADLVQAALDHRGGCVRIGRDLYKPAHRHYASALAADVRTAGALVRSDTAGWQAAVEDHVRAMGCDAVVESALADPDDFRLSSAAYRAAGHRIEVFALATPQALSQLGIVDRFLTETA--AGGGRYVPWENHDACATKMLDTLAVIEAEQLADRVTVVRRDGTVLYSNERTAGGGWRGRCAASQTVL
DSQ  TCTCAGCAGGAGAGCCTCGACGTCCTGCACCGGACG---ATCCTGCCGGCCGCGCTGCAGAGCGCCGTCCCGCAGACCCGGCCGGTTGTGGTCGTCGTCGCTGGACAGCCCGGCGCCGGCAAGACCGCGGCCGCCGATCTGGTCCAGGCCGCACTGGACCACCGCGGCGGCTGCGTACGGATCGGCCGGGACCTGTACAAGCCTGCCCACCGCCATTACGCCAGCGCCTTGGCAGCCGACGTCCGTACCGCCGGGGCCCTGGTGCGTTCTGACACCGCGGGGTGGCAGGCGGCCGTCGAGGACCACGTCCGCGCCATGGGGTGCGACGCCGTGGTGGAGTCGGCGCTCGCCGACCCTGACGACTTCCGCCTCTCCTCCGCCGCCTACCGCGCGGCCGGCCACCGCATCGAGGTCTTCGCGCTGGCGACCCCGCAGGCCCTGAGTCAGCTCGGCATCGTGGACCGCTTCCTCACCGAGACCGCG------GCCGGCGGCGGCCGGTATGTGCCGTGGGAGAACCACGACGCCTGTGCGACCAAGATGCTGGACACACTGGCCGTCATCGAAGCCGAGCAGCTGGCCGACCGTGTCACCGTGGTACGGCGCGACGGCACGGTGCTGTACAGCAACGAGCGCACCGCTGGGGGCGGCTGGCGGGGCCGGTGTGCGGCATCGCAGACGGTCCTC
TRN  11011111101111111
NAM  Q8DTS0_STRMU/6-196
ASQ  YLDYS-KEHLDS-ILSDLFGNKQPSSKKDAIFMAGSPGAGKSEVAHLLADSY---KNMIVLDTDDFRCLFPDYDGSNSSNFQKACSW-------LTEQAFQYLTEKGYSFIYDTTFAVPSTEKKIKRVLKN-GYRPVIFYVYQEPKIAWQFTKDR-------ERVEGRKVPKETFINAFLHARENVEKVKVRHPETLVHLIIKD----YQNTIE---------------E
DSQ  TATTTAGATTATTCT---AAGGAGCACTTGGACAGC---ATTCTATCGGATTTGTTTGGAAATAAGCAACCGAGTTCTAAGAAGGATGCTATCTTTATGGCAGGAAGTCCTGGGGCTGGTAAGTCGGAGGTTGCACATTTGCTAGCTGATAGTTAC---------AAGAATATGATTGTGTTGGATACAGACGATTTTCGTTGTCTCTTTCCAGACTATGATGGTAGTAATTCCAGCAACTTTCAAAAGGCCTGTTCTTGG---------------------CTAACTGAACAAGCTTTTCAGTATCTGACAGAGAAAGGCTACTCATTTATTTACGATACAACTTTTGCTGTGCCGAGTACAGAAAAGAAGATAAAACGTGTCTTGAAGAAT---GGTTACAGGCCTGTGATTTTCTACGTATATCAAGAACCGAAAATTGCTTGGCAGTTTACCAAAGATAGG---------------------GAAAGAGTAGAAGGAAGAAAAGTCCCTAAAGAAACCTTTATCAATGCGTTTTTACATGCAAGAGAAAATGTTGAAAAAGTTAAAGTTCGTCACCCAGAGACCTTAGTACATCTTATCATTAAGGAT------------TATCAGAATACCATTGAA---------------------------------------------GAA
TRN  10010101100011000
//