EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06382 - DUF1074)
FAM  PF06382
PID  DUF1074
DES  Protein of unknown function (DUF1074)
IPR  IPR010477
ANO  2
ALN  103
AID  0.896907
APH  (Q8T3U9_DROME/8-110:0.03140,Q24402_DROME/8-110:0.08548);
ATP  (Q8T3U9_DROME/8-110,Q24402_DROME/8-110);
ATL  0.11687
DNO  2
DLN  309
DID  0.938511
DPH  (Q8T3U9_DROME/8-110:0.00000,Q24402_DROME/8-110:0.06432);
DTP  (Q8T3U9_DROME/8-110,Q24402_DROME/8-110);
DTL  0.06432
RID  0.896907
RPH  (Q8T3U9_DROME/8-110:0.03140,Q24402_DROME/8-110:0.08548);
RTP  (Q8T3U9_DROME/8-110,Q24402_DROME/8-110);
RTL  0.11687
LNK  Q24402_DROME/8-110:Q24402:Z46784
LNK  Q8T3U9_DROME/8-110:Q8T3U9:AY089488
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8T3U9_DROME/8-110
ASQ  ECKSLWNGIISISAKDESPKGLTEMCNHPIRRVPQKCKPIKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAA
DSQ  GAGTGCAAGAGCCTGTGGAATGGCATAATTTCCATTTCTGCAAAAGATGAAAGTCCTAAAGGTCTCACTGAAATGTGTAATCATCCAATAAGGAGAGTACCTCAAAAATGTAAGCCAATAAAGTCCTGTGCAAAGCCGCGCCGAAAGGCAGCCTGTGCCAAGGCGACTCGGCCCAAGGTCAAGTGTGCACCGAGGCAGAAGTGCAGCAAGCAGGGACCTGTCACTAACAACGCCTATTTGAATTTTGTGCGTTCCTTCCGAAAGAAGCACTGTAACTTGAAACCGCGGGAATTAATTGCAAAGGCCGCT
TRN  10010101100011010
NAM  Q24402_DROME/8-110
ASQ  ECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSCAKPRRKRACAKATRPKVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAR
DSQ  GAGTGCAAGAGCCTGTGGAATGGCATAATTTCCATTTCTGCAAAAGATGAAAGTCCTAAAGGTCTCACTGAAATGTGTAATCATCCAAAGAGGAGAGCACCGCCCAAATGTAAGCCAATGAAGTCCTGTGCAAAGCCGCGCCGAAAGCGAGCCTGTGCCAAGGCGACTCGGCCCAAGGTCAAGTGTGCACCGAGTCAGAAGTGCAGCAAGCAGGGACCTGTCACTAACAACGCCTATTTGAATTTCGTGCGTTTCTTCCGAAAGAAGCACTGTGACTTGAAGCCGCAGGAATTAATTGCAGAGGCCCGC
TRN  10010101100011010
//