EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06379 - RhaT)
FAM  PF06379
PID  RhaT
DES  L-rhamnose-proton symport protein (RhaT)
IPR  IPR010476
ANO  2
ALN  344
AID  0.829787
APH  (Q8D1F0_YERPE/19-362:0.05899,RHAT_SALTY/1-344:0.14658);
ATP  (Q8D1F0_YERPE/19-362,RHAT_SALTY/1-344);
ATL  0.20557
DNO  2
DLN  1032
DID  0.73062
DPH  (Q8D1F0_YERPE/19-362:0.12840,RHAT_SALTY/1-344:0.21297);
DTP  (Q8D1F0_YERPE/19-362,RHAT_SALTY/1-344);
DTL  0.34137
RID  0.829787
RPH  (Q8D1F0_YERPE/19-362:0.05899,RHAT_SALTY/1-344:0.14658);
RTP  (Q8D1F0_YERPE/19-362,RHAT_SALTY/1-344);
RTL  0.20557
LNK  Q8D1F0_YERPE/19-362:Q8D1F0:AE013661
LNK  RHAT_SALTY/1-344:P27135:M85157
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8D1F0_YERPE/19-362
ASQ  MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKERAMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMGGGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILAANIVGLGMAA
DSQ  ATGAATAATGCGATTATATTGGGGATAATTTGGCATCTGGTCGGTGCTGCCAGTGCCGCGTGTTTCTACGCGCCGTTTAAACAAGTTAAGAAATGGTCATGGGAAACCATGTGGTCTATTGGGGGGTTGGTCTCCTGGCTTATCCTTCCATGGACGGTCAGCTATCTGTTATTACCTGATTTTTGGCAATATTACGGTTCCTTCAGCATCGCTACCTTACTGCCGGTATTTCTATTCGGCGCTATGTGGGGGATAGGTAACATCAACTATGGCCTGACCATGCGTTACCTTGGGATGTCGATGGGAATAGGGATAGCCATCGGTATCACACTCATTATCGGCACGTTGATGACCCCTATTCTGCAAGGGCGTTTTGATGTGCTCCTCGGTACCCCCGGTGGGCGAATGACCCTTTTAGGGGTGTTCGTCGCCCTGATCGGTGTTGCCATCGTCAGTTATGCCGGGTTACTGAAAGAACGGGCAATGGGCATTCAGGCGGAAGAGTTCAACCTGAAAAAGGGGCTAATATTGGCCGTGATGTGCGGTATTTTCTCCGCCGGTATGTCATTTGCTATGGATGCCGCAAAACCGATGCATGAAGCCGCCAGCGCATTAGGGATCAACTCACTGTATGTCGCCCTACCAAGCTACGTCATAATTATGGGAGGCGGGGCGATCATCAACCTCAGCTATTGTTTTATCCGGTTGGCAACACTTAAAAACTTGTCAGTCAAAGCCGACTTCTCGGTTGCCAAGCCACTGCTGATCACCAACATTCTGTTCTCGGCATTAGCCGGTTTGATGTGGTATCTGCAATTCTTCTTCTATGCTTGGGGCCACGCCAAGATCCCACAACAGTATGATTATATGAGCTGGATGCTGCATATGAGCTTCTATGTATTGTGTGGCGGTATTGTCGGCCTGCTACTCAAAGAGTGGAAATGTTCAACCAAAAAGCCTGTTGCCGTGCTGTGTATTGGTTGTCTGGTGATTATTTTGGCTGCGAATATTGTTGGTTTGGGTATGGCTGCG
TRN  10010101100011000
NAM  RHAT_SALTY/1-344
ASQ  MSNAITMGIFWHLIGAASAACFYAPFKQVKQWSWETMWSVGGIVSWLILPWTISALLLPDFWAYYGQFNLSTLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPIINGNFDVLIHTEGGRMTLLGVFVALIGVGIVTRAGQLKERKMGIKAEEFNLKKGLLLAVMCGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGALVNLGFCFIRLAKVQNLSIKADFSLARPLIISNILLSALGGLMWYLQFFFYAWGHARIPAQYDYMSWMLHMSFYVLCGGLVGLVLKEWKNAGRRPVAVLSLGCVVIIIAANIVGLGMAS
DSQ  ATGAGTAACGCGATTACGATGGGTATTTTCTGGCATTTGATAGGGGCGGCCAGTGCAGCCTGCTTCTATGCCCCGTTCAAGCAAGTGAAACAGTGGTCATGGGAAACCATGTGGTCAGTGGGCGGCATCGTCTCATGGCTTATTCTGCCGTGGACAATTAGCGCTCTGTTACTGCCTGATTTCTGGGCCTATTATGGGCAGTTTAACCTCTCCACCCTTTTACCGGTTTTTCTGTTCGGCGCCATGTGGGGCATCGGCAATATTAACTACGGCCTGACCATGCGTTATCTCGGCATGTCGATGGGTATCGGCATCGCTATCGGCATTACGCTTATCGTCGGCACGCTGATGACGCCTATCATCAACGGTAACTTCGATGTGTTAATTCATACCGAAGGGGGACGCATGACGCTACTTGGCGTTTTTGTCGCGCTGATCGGCGTCGGGATTGTGACGCGCGCCGGACAGTTAAAAGAACGCAAAATGGGCATTAAAGCGGAGGAGTTCAATCTGAAGAAAGGGCTTCTGCTGGCAGTGATGTGCGGTATTTTCTCGGCGGGAATGTCTTTTGCCATGAACGCCGCGAAACCGATGCATGAAGCTGCTGCCGCGCTTGGCGTTGACCCGCTCTATGTCGCGCTGCCGAGTTACGTGGTGATTATGGGCGGCGGCGCGCTGGTGAACCTCGGTTTCTGTTTTATCCGCCTGGCAAAAGTACAAAATCTGTCGATAAAAGCCGACTTCTCGCTGGCAAGACCGTTGATTATCAGCAATATTCTGCTGTCCGCGCTTGGCGGTCTGATGTGGTATTTGCAGTTCTTTTTCTATGCCTGGGGTCACGCGCGCATTCCAGCGCAATATGACTACATGAGCTGGATGCTGCACATGAGCTTCTATGTGCTGTGCGGGGGGCTTGTCGGTCTGGTGCTAAAAGAGTGGAAAAATGCTGGCCGCCGTCCCGTTGCTGTATTAAGCCTCGGCTGCGTGGTAATTATTATCGCGGCGAATATTGTCGGTTTAGGCATGGCCAGT
TRN  10010101100011000
//