EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06365 - CD34_antigen)
FAM  PF06365
PID  CD34_antigen
DES  CD34 antigen protein
IPR  IPR008083
ANO  4
ALN  396
AID  0.662139
APH  (Q9XS61_BOVIN/1-382:0.29946,(CD34_HUMAN/1-385:0.18530,CD34_MOUSE/1-382:0.28408):0.09203,CD34_CANFA/1-389:0.13359);
ATP  (Q9XS61_BOVIN/1-382,(CD34_HUMAN/1-385,CD34_MOUSE/1-382),CD34_CANFA/1-389);
ATL  0.99446
DNO  4
DLN  1188
DID  0.765026
DPH  (Q9XS61_BOVIN/1-382:14.40409,(CD34_HUMAN/1-385:7.54209,CD34_MOUSE/1-382:14.89870):3.03918,CD34_CANFA/1-389:8.11314);
DTP  (Q9XS61_BOVIN/1-382,(CD34_HUMAN/1-385,CD34_MOUSE/1-382),CD34_CANFA/1-389);
DTL  48.0082
RID  0.662139
RPH  (Q9XS61_BOVIN/1-382:0.29946,(CD34_HUMAN/1-385:0.18530,CD34_MOUSE/1-382:0.28408):0.09203,CD34_CANFA/1-389:0.13359);
RTP  (Q9XS61_BOVIN/1-382,(CD34_HUMAN/1-385,CD34_MOUSE/1-382),CD34_CANFA/1-389);
RTL  0.99446
LNK  CD34_CANFA/1-389:Q28270:U49457
LNK  CD34_HUMAN/1-385:P28906:S53910
LNK  CD34_MOUSE/1-382:Q64314:S69293
LNK  Q9XS61_BOVIN/1-382:Q9XS61:AB021662
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9XS61_BOVIN/1-382
ASQ  MLGRRGARAGRGMVRGWTALCLLSLLPSMEFTQTPMAATTATVSASPEISSPVPTTTFDWRSMNSSTFRSTSLYDVSQDSNGTTavTLVPASTDSFTSTSETLPASGAVNSSVQSQTSLATTVSSTLISFATSEATLQPSTFPGNISDSLYNSTS-PVTSSIITSP-SFSP......TQSILKSEIKCSRVKEVKLAHSICLKLNETSSCEEFKKNNEEKLTGFLCQKKQAE------VCSLLLAQSEVRPQCLLLVLTNRTESSSKIKLLEEHWSDLREMGIEDISEEAVSSHQSYSRKTLIALVTSGILLAILITTCYFLMNRRSWSPTGERLGEDPYYVENGGGQGYSSGPEASPEAQGKAIVNRGAQENGTGQATSRNGHSARQRVVADTEL
DSQ  ATGCTGGGCCGCAGGGGCGCGCGCGCGGGGCGCGGGATGGTGCGGGGCTGGACCGCGCTCTGCCTGCTGAGTCTGCTGCCTTCTATGGAATTCACACAGACACCCATGGCAGCTACTACTGCCACAGTGTCAGCCAGCCCAGAAATATCTTCACCTGTCCCTACAACTACATTCGACTGGAGAAGCATGAACTCAAGTACTTTTAGAAGCACCAGCCTCTACGATGTCTCTCAGGACAGCAATGGGACCACAgcagtcACCTTAGTTCCAGCGTCTACAGACAGTTTCACGTCTACCTCTGAGACCCTCCCAGCCTCTGGGGCCGTGAACTCTTCTGTCCAGTCACAGACCTCTTTAGCCACCACGGTGTCTTCTACCCTCATCAGCTTTGCGACTTCAGAGGCGACTCTGCAGCCCAGCACTTTTCCTGGAAATATTTCGGATTCCCTGTACAATAGTACCAGC---CCTGTGACTTCTTCCATTATTACCTCTCCA---TCATTTTCTCCT..................ACCCAAAGTATCCTCAAGAGTGAAATAAAATGTTCCAGAGTCAAAGAAGTGAAATTGGCCCACAGCATCTGCCTGAAGCTAAATGAGACCTCCAGCTGTGAGGAGTTTAAGAAGAACAATGAAGAGAAACTGACCGGATTCCTGTGTCAGAAGAAACAGGCCGAG------------------GTGTGCTCCTTGCTCCTGGCCCAGTCTGAGGTGAGGCCTCAGTGCCTGCTGCTGGTCCTGACCAACAGGACAGAAAGTTCCAGCAAGATCAAACTTCTGGAAGAGCACTGGTCTGACCTGAGAGAGATGGGCATCGAGGACATCTCTGAAGAAGCTGTCAGCAGCCACCAGAGCTATTCCCGGAAGACCTTGATTGCACTGGTCACCTCGGGGATCCTGCTGGCCATCTTGATCACCACGTGCTATTTCCTGATGAACCGCCGCAGCTGGAGCCCAACGGGAGAAAGGCTGGGCGAAGACCCTTATTACGTGGAGAACGGTGGAGGCCAGGGCTATAGCTCAGGCCCTGAGGCCTCCCCCGAGGCTCAGGGAAAGGCCATTGTGAATCGAGGGGCTCAGGAGAATGGCACCGGCCAGGCCACCTCCAGAAACGGCCATTCAGCGAGACAACGTGTGGTGGCTGATACCGAACTG
TRN  10010101100011000
NAM  CD34_MOUSE/1-382
ASQ  MQVHRDTRAGLLLPWRWVALCLMSLL------HLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTT..PAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSS......APSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENGTGQATSRNGHSARQHVVADTEL
DSQ  ATGCAGGTCCACAGGGACACGCGCGCGGGGCTCCTGCTGCCATGGCGCTGGGTAGCTCTCTGCCTGATGAGTCTGCTG------------------CATCTAAATAACTTGACTTCTGCTACCACGGAGACTTCTACACAAGGAATATCCCCATCAGTTCCTACCAATGAGTCTGTTGAGGAAAATATCACATCTAGCATCCCTGGAAGTACCAGCCACTACTTGATCTATCAGGACAGCAGTAAGACCACA......CCAGCCATCTCAGAGACTATGGTCAACTTTACAGTTACCTCTGGGATCCCTTCAGGCTCTGGAACTCCACACACTTTTTCACAACCACAGACTTCCCCAACTGGCATACTGCCTACTACTTCAGACAGTATTTCCACTTCAGAGATGACCTGGAAGTCCAGCCTGCCATCTATAAATGTTTCTGATTATTCGCCTAATAATAGCAGCTTTGAGATGACATCACCCACCGAGCCATATGCTTACACATCATCTTCT..................GCTCCGAGTGCCATTAAGGGAGAAATCAAATGCTCTGGAATCCGAGAAGTGAGGTTGGCCCAGGGTATCTGCCTGGAACTAAGTGAAGCATCTAGTTGTGAGGAGTTTAAGAAGGAAAAGGGAGAAGATCTAATTCAAATACTGTGTGAAAAGGAGGAGGCTGAGGCTGATGCTGGTGCTAGTGTCTGCTCCCTGCTTCTAGCCCAGTCTGAGGTTAGGCCTGAGTGTTTGCTGATGGTCTTGGCCAATAGCACAGAACTTCCCAGCAAACTCCAGCTTATGGAAAAGCACCAATCTGACTTGAGAAAGCTGGGGATCCAAAGCTTCAATAAACAAGATATCGGGAGCCACCAGAGCTATTCCCGAAAGACTCTTATTGCATTGGTCACCTCTGGAGTTCTGCTGGCCATCTTGGGCACCACTGGTTATTTCCTGATGAACCGTCGCAGTTGGAGCCCTACAGGAGAAAGGCTGGGTGAAGACCCTTATTACACGGAGAATGGTGGAGGCCAGGGCTATAGCTCAGGACCTGGGGCCTCCCCTGAGACTCAGGGAAAGGCCAATGTGACCCGAGGGGCTCAGGAGAACGGGACCGGCCAGGCCACTTCCAGAAACGGCCATTCAGCAAGACAACATGTGGTGGCTGACACAGAACTG
TRN  10010101100011001
NAM  CD34_CANFA/1-389
ASQ  MLAGRGARAGGGLPRGWTALCLLSLL-PFGFTNTETVITPTTVPTSTEIMSAVSENTSKREAITLTPSGTTTLYSVSQDSSGTT..ATISETTVHVTSTSEITLTPGTMNSSVQSQTSLAITVSFTPTNFSTSSVTLEPSLLPGNGSDPPYNSTS-LVTSPTEYYT-SLSPtpsrndTPSTIKGEIKCSGVKEVKLNQGICLELNETSSCEDFKKDNEEKLTQVLCEKEPAEA--GAGVCSLLLAQSEVRPHCLLLVLANKTELFSKLQLLRKHQSDLKKLGIRDFTEQDVGSHQSYSRKTLIALVTSGILLAVLGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGVSPEAQGKASVNRGPQENGTGQATSRNGHSARQHMVADTEL
DSQ  ATGCTGGCGGGCAGGGGCGCGCGCGCGGGCGGCGGGCTGCCGCGGGGCTGGACCGCGCTCTGCCTGCTCAGTCTGCTG---CCCTTTGGGTTCACAAACACAGAAACCGTGATTACTCCTACCACAGTGCCAACCTCCACAGAAATAATGTCAGCTGTTTCTGAGAATACATCCAAACGGGAAGCCATCACACTAACTCCTTCTGGAACTACCACCCTGTACTCTGTCTCTCAAGACAGCAGTGGGACCACA......GCAACCATCTCAGAGACTACAGTCCATGTCACATCTACCTCTGAGATCACCCTAACGCCTGGGACCATGAACTCTTCTGTTCAGTCGCAGACCTCTTTAGCTATCACGGTATCTTTTACCCCAACCAACTTTTCAACTTCAAGTGTGACCTTGGAGCCCAGCCTGCTACCTGGAAATGGTTCGGATCCCCCCTACAACAGCACCAGC---CTTGTGACATCCCCCACGGAATATTATACA---TCACTTTCTCCTaccccaagtagaaatgacACCCCAAGTACCATCAAGGGAGAAATCAAATGTTCCGGAGTCAAAGAAGTGAAATTGAACCAAGGTATCTGCCTAGAGCTAAATGAGACCTCCAGCTGTGAGGACTTTAAGAAAGATAACGAAGAAAAACTGACCCAAGTCCTGTGTGAGAAGGAGCCAGCTGAGGCT------GGGGCCGGGGTGTGCTCCCTGCTTCTGGCCCAGTCTGAGGTGAGGCCTCACTGCCTGCTGCTGGTCTTGGCCAACAAAACAGAACTTTTCAGTAAACTCCAACTTCTGAGAAAGCACCAGTCTGACCTGAAAAAGCTGGGGATCCGAGACTTCACTGAACAAGATGTTGGGAGCCACCAGAGCTATTCCCGCAAGACCCTGATTGCACTGGTCACCTCAGGGATCCTGCTGGCTGTCTTGGGCACCACTGGTTACTTCCTGATGAACCGCCGCAGTTGGAGCCCTACAGGAGAAAGGCTGGGCGAAGACCCTTATTACACGGAGAACGGTGGAGGCCAGGGCTATAGCTCAGGCCCTGGGGTCTCCCCTGAGGCTCAGGGAAAGGCCAGTGTGAACCGTGGGCCTCAGGAGAACGGGACCGGCCAGGCCACGTCCAGAAACGGCCATTCAGCAAGACAACACATGGTGGCTGATACAGAATTG
TRN  10010101100011000
NAM  CD34_HUMAN/1-385
ASQ  MLVRRGARAGPRMPRGWTALCLLSLL-PSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEAT..TNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTS-LATSPTKPYT-SSSP......ILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
DSQ  ATGCTGGTCCGCAGGGGCGCGCGCGCAGGGCCCAGGATGCCGCGGGGCTGGACCGCGCTTTGCTTGCTGAGTTTGCTG---CCTTCTGGGTTCATGAGTCTTGACAACAACGGTACTGCTACCCCAGAGTTACCTACCCAGGGAACATTTTCAAATGTTTCTACAAATGTATCCTACCAAGAAACTACAACACCTAGTACCCTTGGAAGTACCAGCCTGCACCCTGTGTCTCAACATGGCAATGAGGCCACA......ACAAACATCACAGAAACGACAGTCAAATTCACATCTACCTCTGTGATAACCTCAGTTTATGGAAACACAAACTCTTCTGTCCAGTCACAGACCTCTGTAATCAGCACAGTGTTCACCACCCCAGCCAACGTTTCAACTCCAGAGACAACCTTGAAGCCTAGCCTGTCACCTGGAAATGTTTCAGACCTTTCAACCACTAGCACTAGC---CTTGCAACATCTCCCACTAAACCCTATACA---TCATCTTCTCCT..................ATCCTAAGTGACATCAAGGCAGAAATCAAATGTTCAGGCATCAGAGAAGTGAAATTGACTCAGGGCATCTGCCTGGAGCAAAATAAGACCTCCAGCTGTGCGGAGTTTAAGAAGGACAGGGGAGAGGGCCTGGCCCGAGTGCTGTGTGGGGAGGAGCAGGCTGATGCTGATGCTGGGGCCCAGGTATGCTCCCTGCTCCTTGCCCAGTCTGAGGTGAGGCCTCAGTGTCTACTGCTGGTCTTGGCCAACAGAACAGAAATTTCCAGCAAACTCCAACTTATGAAAAAGCACCAATCTGACCTGAAAAAGCTGGGGATCCTAGATTTCACTGAGCAAGATGTTGCAAGCCACCAGAGCTATTCCCAAAAGACCCTGATTGCACTGGTCACCTCGGGAGCCCTGCTGGCTGTCTTGGGCATCACTGGCTATTTCCTGATGAATCGCCGCAGCTGGAGCCCCACAGGAGAAAGGCTGGGCGAAGACCCTTATTACACGGAAAACGGTGGAGGCCAGGGCTATAGCTCAGGACCTGGGACCTCCCCTGAGGCTCAGGGAAAGGCCAGTGTGAACCGAGGGGCTCAGGAAAACGGGACCGGCCAGGCCACCTCCAGAAACGGCCATTCAGCAAGACAACACGTGGTGGCTGATACCGAATTG
TRN  10010101100011000
//