EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06304 - DUF1048)
FAM  PF06304
PID  DUF1048
DES  Protein of unknown function (DUF1048)
IPR  IPR008316
ANO  6
ALN  105
AID  0.352327
APH  (Q9K5V7_BACHD/8-110:0.20042,((Q9CDZ2_LACLA/11-111:0.78995,(Q8Y922_LISMO/6-107:0.74840,Q9K5W0_BACHD/7-110:0.85702):0.18243):0.07955,Q9CDZ3_LACLA/7-105:0.57066):0.12984,Q9K5W1_BACHD/4-105:0.89699);
ATP  (Q9K5V7_BACHD/8-110,((Q9CDZ2_LACLA/11-111,(Q8Y922_LISMO/6-107,Q9K5W0_BACHD/7-110)),Q9CDZ3_LACLA/7-105),Q9K5W1_BACHD/4-105);
ATL  4.45526
DNO  6
DLN  315
DID  0.494936
DPH  (((Q9K5W0_BACHD/7-110:0.42397,Q8Y922_LISMO/6-107:0.46533):0.09753,Q9K5W1_BACHD/4-105:0.44327):0.13522,Q9K5V7_BACHD/8-110:0.23243,(Q9CDZ3_LACLA/7-105:0.34345,Q9CDZ2_LACLA/11-111:0.45982):0.08428);
DTP  (((Q9K5W0_BACHD/7-110,Q8Y922_LISMO/6-107),Q9K5W1_BACHD/4-105),Q9K5V7_BACHD/8-110,(Q9CDZ3_LACLA/7-105,Q9CDZ2_LACLA/11-111));
DTL  2.6853
RID  0.352327
RPH  (Q9K5V7_BACHD/8-110:0.20042,((Q9CDZ2_LACLA/11-111:0.78995,(Q8Y922_LISMO/6-107:0.74840,Q9K5W0_BACHD/7-110:0.85702):0.18243):0.07955,Q9CDZ3_LACLA/7-105:0.57066):0.12984,Q9K5W1_BACHD/4-105:0.89699);
RTP  (Q9K5V7_BACHD/8-110,((Q9CDZ2_LACLA/11-111,(Q8Y922_LISMO/6-107,Q9K5W0_BACHD/7-110)),Q9CDZ3_LACLA/7-105),Q9K5W1_BACHD/4-105);
RTL  4.45526
LNK  Q8Y922_LISMO/6-107:Q8Y922:AL591976
LNK  Q9CDZ2_LACLA/11-111:Q9CDZ2:AE006436
LNK  Q9CDZ3_LACLA/7-105:Q9CDZ3:AE006436
LNK  Q9K5V7_BACHD/8-110:Q9K5V7:BA000004
LNK  Q9K5W0_BACHD/7-110:Q9K5W0:BA000004
LNK  Q9K5W1_BACHD/4-105:Q9K5W1:BA000004
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9K5W1_BACHD/4-105
ASQ  KKIIEGKREWRAHVSRVEKLPKDYQIVYKEIQKYLFKVGP-VELNEGIGLLSEILGFFEEGAAAGKGVLDVTGTDVAAFCDALIGD--SKTYADLYQESIQQHVD
DSQ  AAAAAAATCATCGAAGGCAAAAGAGAATGGAGAGCCCATGTTTCCCGTGTTGAAAAATTGCCAAAAGATTACCAAATCGTCTATAAAGAGATCCAAAAATATCTCTTCAAAGTCGGTCCT---GTTGAGCTAAACGAAGGCATTGGGCTGCTCTCGGAAATTCTCGGCTTCTTTGAAGAAGGCGCAGCTGCCGGAAAAGGAGTGCTTGACGTCACAGGAACAGACGTTGCGGCTTTCTGCGATGCGCTGATTGGAGAT------TCAAAAACGTACGCTGATCTTTATCAAGAATCAATCCAACAACACGTCGAT
TRN  10010101100011001
NAM  Q9K5V7_BACHD/8-110
ASQ  IGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTDWQDTKRIFGGILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDT--KTWMDKYRTKLNDSIG
DSQ  ATCGGAAGTCTGAATGACAAGCGAGAATGGAAGGCGATGGAGGCCCGTGCGAAGGCACTTCCAAAGGAGTATCATCACGCTTACAAAGCAATTCAAAAATATATGTGGACATCTGGAGGCCCCACCGACTGGCAAGACACCAAGCGTATTTTTGGTGGCATTCTTGACCTTTTTGAGGAAGGAGCAGCGGAAGGCAAGAAAGTCACTGATCTCACGGGTGAGGACGTGGCCGCATTCTGTGATGAATTAATGAAGGATACG------AAAACCTGGATGGACAAATATCGCACGAAGTTGAACGATTCAATTGGT
TRN  11011101101011000
NAM  Q9CDZ2_LACLA/11-111
ASQ  MIGLEEKREFHEFENRAQKLGENYYEDYKELKKYIWH-SGVTKWADFKFIFGQVLDLLEEAKIQDKELTDLIGPDVATFIDEMMDD---NSWGKKQKNKLNKELK
DSQ  ATGATTGGTCTTGAAGAAAAAAGAGAATTTCACGAATTTGAAAATCGTGCTCAGAAACTTGGAGAGAATTATTATGAAGATTATAAGGAATTAAAAAAATATATATGGCAC---TCTGGGGTAACGAAATGGGCAGATTTCAAATTTATTTTTGGACAAGTTCTTGATTTACTTGAAGAAGCTAAAATCCAAGACAAAGAATTGACTGATTTAATTGGTCCAGATGTTGCGACGTTTATTGATGAGATGATGGATGAT---------AATAGTTGGGGAAAAAAGCAAAAAAATAAACTTAATAAGGAGCTGAAA
TRN  10010101100011010
NAM  Q9CDZ3_LACLA/7-105
ASQ  SDLLAEKKDWQEMQNRAKKLPKDFYQAYRSIQKYMFKMGA-TDW----HIFNDIIELFELAVVDGRSPAEVLGDDVATFADKLLSDN-KEDWRNKYRQALNDYFA
DSQ  AGTGACCTTCTTGCTGAAAAAAAAGACTGGCAAGAAATGCAAAATCGAGCTAAAAAATTACCTAAAGATTTTTATCAGGCTTATCGTTCAATTCAAAAATATATGTTCAAAATGGGGGCA---ACAGATTGG------------CATATTTTTAATGATATTATTGAATTATTTGAACTGGCAGTAGTTGATGGGCGAAGCCCAGCAGAGGTTCTGGGCGATGATGTTGCAACTTTTGCTGATAAATTATTAAGTGATAAT---AAAGAGGATTGGCGAAATAAATATCGTCAAGCTTTGAATGATTATTTTGCT
TRN  11011101101011000
NAM  Q8Y922_LISMO/6-107
ASQ  KKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK---GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRDSIK
DSQ  AAAAAATACCGCGAAGAAAAACGAGATTATAAACAGTACAAAAAACGAATAGCCGCTTTGCCAGAAGATTATAAAACCGCAATGAAAGCTATCGAAACCTATTTATGGAACTTTGCAAAA---------GGTGCTGGGATGTTTGAAATCCTAAAGAATGTACTCGAGATGTTCGAAAACGCCGCCGCCGACAACCTAGAATTAAAAGCCGTTGTAGGAGATGACCTAGCGGAATTCGCCGACAACTTACTAAGTGAATTTCCGGAAGAAACATGGATGGATAAACAACGTCAGAAATTGCGAGATTCGATTAAA
TRN  10010101110011010
NAM  Q9K5W0_BACHD/7-110
ASQ  ITGSDMTKEMKGFETRAKVLPAEYRAAWEEITSNLWLHSDFT-GRNLMPILDSALELLEVASADGQSVEEVLGDDIEGFCAALVGDQGAKTFRDKWRDQLNKNVA
DSQ  ATAACCGGCAGCGATATGACGAAAGAAATGAAAGGCTTTGAAACACGAGCAAAAGTCTTGCCAGCTGAATATCGAGCGGCTTGGGAAGAAATCACAAGTAATCTGTGGCTTCACAGTGACTTCACC---GGTCGTAATCTGATGCCGATTCTTGATAGTGCTCTGGAACTGCTTGAAGTTGCCTCAGCAGATGGCCAGAGCGTCGAAGAAGTACTGGGAGATGATATCGAAGGCTTCTGCGCCGCCCTTGTTGGTGACCAAGGTGCAAAAACGTTTAGAGATAAATGGCGTGACCAACTGAACAAGAACGTAGCA
TRN  10010101100011001
//