EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06299 - DUF1045)
FAM  PF06299
PID  DUF1045
DES  Protein of unknown function (DUF1045)
IPR  IPR009389
ANO  7
ALN  232
AID  0.46506
APH  (((Q8G162_BRUSU/1-232:0.35901,((Q8UCZ9_AGRT5/1-232:0.25086,Q92UG1_RHIME/1-232:0.36973):0.22612,Q98CW2_RHILO/1-232:0.42258):0.09704):0.09645,Q8UIX1_AGRT5/1-225:0.36272):0.61576,Q981P6_RHILO/7-233:0.13407,Q982C2_RHILO/9-236:0.12043);
ATP  (((Q8G162_BRUSU/1-232,((Q8UCZ9_AGRT5/1-232,Q92UG1_RHIME/1-232),Q98CW2_RHILO/1-232)),Q8UIX1_AGRT5/1-225),Q981P6_RHILO/7-233,Q982C2_RHILO/9-236);
ATL  3.05479
DNO  7
DLN  696
DID  0.548586
DPH  (Q8UIX1_AGRT5/1-225:0.35584,((Q8UCZ9_AGRT5/1-232:0.23186,Q92UG1_RHIME/1-232:0.28047):0.13420,(Q8G162_BRUSU/1-232:0.31392,Q98CW2_RHILO/1-232:0.27416):0.07628):0.05438,(Q981P6_RHILO/7-233:0.11013,Q982C2_RHILO/9-236:0.11112):0.43805);
DTP  (Q8UIX1_AGRT5/1-225,((Q8UCZ9_AGRT5/1-232,Q92UG1_RHIME/1-232),(Q8G162_BRUSU/1-232,Q98CW2_RHILO/1-232)),(Q981P6_RHILO/7-233,Q982C2_RHILO/9-236));
DTL  2.38041
RID  0.46506
RPH  (((Q8G162_BRUSU/1-232:0.35901,((Q8UCZ9_AGRT5/1-232:0.25086,Q92UG1_RHIME/1-232:0.36973):0.22612,Q98CW2_RHILO/1-232:0.42258):0.09704):0.09645,Q8UIX1_AGRT5/1-225:0.36272):0.61576,Q981P6_RHILO/7-233:0.13407,Q982C2_RHILO/9-236:0.12043);
RTP  (((Q8G162_BRUSU/1-232,((Q8UCZ9_AGRT5/1-232,Q92UG1_RHIME/1-232),Q98CW2_RHILO/1-232)),Q8UIX1_AGRT5/1-225),Q981P6_RHILO/7-233,Q982C2_RHILO/9-236);
RTL  3.05479
LNK  Q8G162_BRUSU/1-232:Q8G162:AE014291
LNK  Q8UCZ9_AGRT5/1-232:Q8UCZ9:AE009182
LNK  Q8UIX1_AGRT5/1-225:Q8UIX1:AE008991
LNK  Q92UG1_RHIME/1-232:Q92UG1:AL591985
LNK  Q981P6_RHILO/7-233:Q981P6:BA000013
LNK  Q982C2_RHILO/9-236:Q982C2:BA000013
LNK  Q98CW2_RHILO/1-232:Q98CW2:BA000012
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98CW2_RHILO/1-232
ASQ  MRYAIYFTPRQDEPLARIAANWLGRDPFGAATRPVEAVADLAAEEVAFHTASARRYGFHATLKAPFRLAASETEASLRAGLDHFAEATPVVTIPRLVVSQIDSFFALVPEGPLPPLNRFADEVVRDFDRFRAPLTEAEIERRSPDSLKPAEFRNLCQWGYPYVFETFRFHMTLSGRAGPQESPRLRAAINSLFADILRQPVLVDALTLFVEPEPGAPFMVLSQHALGRRPAR
DSQ  ATGCGTTATGCCATCTACTTCACCCCCCGGCAGGACGAACCGCTGGCGCGGATCGCCGCCAACTGGCTGGGCCGTGACCCGTTCGGCGCGGCGACAAGGCCGGTCGAGGCCGTGGCCGATCTGGCGGCGGAGGAAGTTGCCTTCCACACCGCCTCGGCCCGCCGCTATGGCTTCCACGCGACGCTGAAAGCCCCCTTCCGCCTGGCCGCCAGCGAGACCGAGGCTTCGCTGCGCGCGGGGCTCGACCATTTTGCCGAAGCGACGCCTGTCGTGACGATCCCGCGTCTCGTCGTCAGCCAGATCGACAGCTTCTTCGCGCTGGTGCCGGAGGGGCCGCTGCCGCCACTCAACCGTTTCGCCGACGAGGTGGTGCGCGACTTCGACCGGTTCCGCGCGCCGCTGACCGAGGCCGAAATCGAGCGGCGCAGCCCGGATTCGCTGAAGCCGGCCGAGTTCCGCAATCTCTGCCAATGGGGCTACCCCTATGTCTTCGAGACTTTCCGCTTCCACATGACGCTGTCAGGCCGGGCCGGGCCACAGGAAAGCCCTCGTTTGCGCGCAGCAATCAACAGCCTGTTCGCGGATATACTGCGGCAGCCGGTGCTGGTCGACGCGCTGACGCTGTTTGTCGAACCTGAACCTGGTGCGCCGTTCATGGTGCTTTCGCAGCACGCGCTGGGACGCCGCCCGGCGAGA
TRN  10010101100011001
NAM  Q8G162_BRUSU/1-232
ASQ  MRYAIYFTPPSNDALLRVGANWLGRNAFSGEPVKMPALRSLETDEICRLTEKPRRYGFHATMKAPFRLAGEHSENDLLAALMHFASSAAPVVIPRLELQSISSFFALVPEEPVAELNQLANDVVVAFDRFRAPLSEAEIARRRPERLNERQRHNLVRWGYPYVFEEFRFHMTLTGPVEEKDRSRVERVLEEFFTPMLDDCVEVANLALFVEPEEGAPFEVHSLHPLSGGKAA
DSQ  ATGCGTTATGCGATTTATTTCACGCCGCCATCCAATGATGCGCTTTTGAGGGTTGGCGCAAACTGGCTGGGCCGCAACGCTTTCAGCGGGGAGCCGGTCAAGATGCCGGCATTGCGCTCTCTGGAAACGGACGAGATATGTCGCCTTACTGAAAAGCCGCGCCGCTATGGCTTTCACGCAACCATGAAAGCGCCGTTCCGTCTGGCCGGGGAGCATTCCGAAAATGACCTTCTGGCCGCACTGATGCATTTTGCGTCTTCTGCCGCACCGGTGGTGATTCCACGCCTTGAGCTCCAGTCCATCAGCTCTTTCTTCGCGCTTGTGCCGGAAGAGCCGGTGGCGGAACTCAACCAGTTGGCCAATGATGTGGTGGTTGCATTCGACCGTTTTCGGGCGCCATTGAGTGAAGCCGAGATTGCGCGGCGGCGGCCAGAGCGGCTGAATGAGCGGCAGCGCCACAATCTGGTGCGCTGGGGCTATCCTTATGTTTTTGAGGAATTCCGGTTCCATATGACATTGACCGGGCCTGTCGAGGAAAAGGACCGCAGCCGCGTGGAACGGGTGCTGGAGGAGTTTTTCACTCCTATGCTGGACGATTGCGTGGAGGTTGCCAATCTCGCTTTGTTTGTAGAACCTGAGGAAGGGGCGCCTTTCGAGGTTCATTCGCTGCATCCGCTAAGCGGTGGCAAAGCGGCT
TRN  10010101100011011
NAM  Q8UIX1_AGRT5/1-225
ASQ  MRYAIYFSPAKDHPLTEAASRWLGRNAFSGT------LHD-DHDDYADLTEEPRRYGFHATLKAPFELAEKYSEAELLAAVEDFAANQSAFEIPRVVVGALGPFFALVPDRVYQPLQDFAAEVVDHFDRFRAPLSETDIARRRPQMLTESQRQNLSLWGYPHVMDDFRFHMTLTGRIDEEEQPAMQEILSTRFAEFVDQPLAISGLALFIEETRGAPFTVHRWHPLGQQPKK
DSQ  GTGCGCTACGCCATCTATTTTTCTCCGGCTAAAGATCATCCGCTGACTGAAGCAGCGTCGCGCTGGCTGGGCCGCAATGCGTTTTCCGGCACG------------------TTGCATGAC---GACCACGACGACTATGCCGATTTGACGGAGGAACCGCGCCGTTACGGTTTCCACGCGACCCTGAAAGCACCTTTCGAGCTCGCCGAAAAATACAGCGAGGCCGAGCTGCTCGCAGCGGTCGAAGATTTCGCGGCCAATCAGTCCGCCTTCGAGATCCCACGCGTCGTCGTCGGCGCGCTTGGGCCGTTTTTCGCGCTGGTCCCGGATCGCGTTTACCAGCCGCTGCAGGATTTTGCCGCAGAGGTCGTTGATCACTTCGATCGGTTCCGCGCGCCCCTGTCCGAGACCGATATTGCCCGCCGGCGGCCGCAAATGCTGACGGAAAGCCAGCGACAAAATCTCTCTCTCTGGGGTTATCCGCATGTCATGGATGACTTCCGTTTTCACATGACGCTGACCGGCCGTATCGACGAGGAAGAGCAGCCCGCCATGCAAGAGATTCTCTCGACCCGGTTTGCCGAATTCGTCGATCAGCCTCTCGCCATTTCCGGCCTCGCTTTATTCATTGAAGAAACGCGCGGCGCGCCATTTACCGTTCATCGCTGGCACCCGCTTGGCCAGCAGCCAAAGAAA
TRN  11011101101011010
NAM  Q92UG1_RHIME/1-232
ASQ  MRYAICFTPPMGDPLSAAAASWLGRSVYSGEAVELPSIAGLAVSEMAFYTAVPRRFGFHAMIMAPFRLRPDMDEAQLLKAMMLFTSGETPFQIERLEVARLSQCWGLMPEVPSQSMHLLAARVLQALDRFRAPLSEDDIERADPDRLTAPQFTNLHRWGDPHVMDEYRFHMPLTGPLNVDVGRRVEAPLRGLFEPLLSEPLLIGSLALFIEHEPGAPMRVHSQHPLGKISAR
DSQ  ATGCGCTATGCGATCTGTTTCACCCCGCCGATGGGAGACCCGCTTTCTGCGGCAGCTGCCAGCTGGCTCGGCCGCAGCGTCTATTCCGGGGAGGCCGTGGAACTGCCGTCGATTGCCGGCCTTGCGGTTTCGGAGATGGCCTTTTACACGGCCGTTCCACGCCGCTTCGGCTTTCATGCAATGATCATGGCGCCCTTCCGCCTGAGGCCGGATATGGACGAAGCGCAATTGCTCAAGGCCATGATGCTTTTCACGAGCGGGGAGACGCCGTTCCAGATCGAGCGGCTGGAGGTTGCGCGCCTCAGCCAGTGCTGGGGGCTGATGCCAGAGGTGCCCAGCCAGTCGATGCATCTGCTCGCCGCCCGAGTCCTGCAGGCGCTCGACCGGTTTCGCGCTCCGCTGAGTGAGGACGATATCGAACGGGCGGACCCGGACAGGCTCACGGCTCCGCAATTCACCAACCTGCATCGCTGGGGCGATCCCCATGTGATGGACGAATATCGTTTCCACATGCCGCTGACCGGCCCTCTGAACGTCGATGTGGGGCGGCGGGTTGAGGCCCCCTTGCGCGGATTGTTCGAACCGCTGCTGAGCGAGCCGCTCCTGATCGGCAGCCTCGCCCTGTTCATCGAGCACGAGCCCGGAGCGCCGATGCGCGTGCATTCGCAGCATCCGCTTGGAAAGATTTCCGCGCGC
TRN  10010101100011011
NAM  Q8UCZ9_AGRT5/1-232
ASQ  MRYAIHFTPSPNDPLTQAAAAWLGRDVYSGHAVEPPGTIDLGMQEISYHTALPRRYGFHGTIKAPFRLAEGQSEAALLRDLMYFSGRQDPFTLPQLVVARQENVFSLVPERPCEVLHFFAARVVQEFDHYRAPLSEAEIERADPDRLSASQLTNLHRWGSPHVMDEFRFQMSLTGGVDPSSSQRIERAVRKVFEPLLTRTLQFSSLALFIEDEPGAPFRVHSLHPMGRVSAR
DSQ  ATGCGATACGCCATTCATTTCACGCCTTCCCCCAATGACCCGCTGACGCAGGCTGCCGCCGCGTGGCTGGGGCGCGATGTCTATTCCGGTCATGCGGTGGAGCCGCCGGGCACGATCGATCTCGGCATGCAGGAGATTTCCTACCACACGGCCCTGCCGCGCCGTTACGGTTTCCACGGCACCATCAAAGCGCCTTTCCGCCTCGCCGAGGGCCAGTCCGAAGCGGCGTTGCTGCGCGACCTGATGTATTTTTCCGGCAGGCAGGATCCCTTCACGCTGCCGCAACTGGTGGTGGCAAGACAGGAGAATGTCTTCAGCCTCGTTCCCGAGCGTCCCTGCGAAGTGCTGCATTTCTTTGCCGCCCGCGTGGTGCAGGAATTCGACCATTACCGCGCACCGCTCTCCGAGGCGGAAATCGAGCGTGCCGATCCGGATCGGCTATCGGCCTCGCAGCTCACCAATCTGCACCGCTGGGGTAGCCCGCATGTCATGGATGAATTCCGTTTCCAGATGTCGCTGACGGGCGGTGTGGACCCTTCCAGCAGCCAGAGGATCGAGCGGGCCGTCCGCAAGGTGTTCGAGCCGCTCTTGACCAGGACGCTGCAATTTTCCAGCCTCGCGCTTTTCATCGAGGATGAGCCCGGTGCGCCTTTCCGCGTGCATTCGCTGCATCCCATGGGCCGCGTTTCAGCCCGC
TRN  10010101100011001
NAM  Q982C2_RHILO/9-236
ASQ  RRYAIYYAPRPEHPLTAAAVHWLGRDAFGRVEVG----GDARPEGEVLLTSEPRRYGFHATLKAPFRLREGASAEDLEEALGGFAASRPACPIGPLKIDLIDGFFALVPVSPIPALRGFAAQIVEEFDCFRAPMDGDELERRMSRQFDEVEMTNLVTWGYPYVLGRFRFHLTLTDRVPENGRAATRARLEERFGPYLSEDYHIDTLSLFVQEHRGADFAVRSQFALKTGAAL
DSQ  CGCCGATACGCAATCTACTACGCGCCAAGGCCTGAACACCCGCTGACGGCCGCCGCAGTACATTGGCTCGGCCGCGATGCGTTCGGCAGGGTTGAAGTTGGC------------GGAGACGCCCGACCCGAGGGCGAGGTCCTTCTCACGTCGGAACCGCGCCGGTACGGCTTTCACGCGACACTCAAGGCACCCTTCCGGTTGAGAGAAGGCGCTTCGGCCGAGGATTTGGAGGAGGCGCTCGGTGGGTTTGCAGCGTCACGGCCGGCCTGCCCGATCGGGCCATTGAAAATAGATCTCATTGACGGTTTCTTCGCGCTCGTTCCCGTCAGTCCCATCCCGGCCTTGCGCGGGTTTGCGGCGCAGATCGTCGAAGAATTTGACTGTTTTCGGGCACCAATGGATGGAGACGAGCTCGAGCGGCGCATGAGCCGCCAATTCGACGAGGTCGAGATGACCAACCTCGTCACCTGGGGCTACCCCTACGTCTTGGGCCGGTTTCGCTTCCACCTGACCTTGACCGATCGCGTACCCGAAAACGGGCGCGCCGCAACGCGGGCACGCCTGGAGGAGAGGTTCGGGCCGTATCTATCCGAAGATTATCATATCGACACCCTGTCGCTCTTCGTGCAGGAACACCGTGGTGCCGATTTCGCGGTCCGATCGCAGTTCGCACTGAAGACCGGCGCGGCCCTT
TRN  10010101100011001
NAM  Q981P6_RHILO/7-233
ASQ  PRYGIYYTPAREHPLTVAAISWLGRDAFQAD-----ATRDARPEAGGLITSEPRRYGFHATLKAPFRLREDTSVEELEQALGRFAASRPPCPIGPFKIDLFGDFFALVPASPIPTLRGFAAQTVEEFDRFRAPMDGDDLERRMSRQVDEVETTNLITWGYPYVLGLFRFHMTLTDRVPRDGREAMRARLEGRFEPYLSEDYHIDAMSLFVQEHRSADFVVRSQFALKTGAAL
DSQ  CCTCGCTACGGAATTTACTACACCCCAGCTCGGGAACATCCGCTGACGGTGGCGGCGATTTCATGGCTTGGCCGCGATGCGTTTCAGGCTGAT---------------GCTACCCGAGATGCCCGGCCGGAAGCTGGCGGCCTTATCACCTCAGAACCACGCCGATACGGTTTTCACGCCACGCTCAAGGCACCCTTCCGGTTGAGAGAAGACACTTCGGTTGAGGAACTGGAACAGGCGCTCGGCAGGTTTGCTGCCTCGCGGCCTCCTTGTCCGATCGGACCGTTCAAAATCGATCTTTTCGGCGACTTCTTCGCGCTTGTTCCCGCCAGTCCTATCCCAACCTTGCGCGGTTTTGCGGCGCAGACCGTCGAAGAATTCGATCGCTTCCGGGCGCCGATGGACGGAGACGACCTCGAGCGGCGCATGAGCCGCCAAGTCGACGAGGTCGAAACGACCAACCTCATCACCTGGGGCTATCCTTATGTCCTGGGCCTGTTCCGCTTCCACATGACCTTGACCGATCGCGTGCCGCGAGATGGACGCGAGGCGATGCGGGCGCGCCTGGAGGGGAGGTTCGAGCCGTATCTATCCGAAGATTACCACATCGATGCCATGTCACTCTTCGTGCAGGAACACCGCAGTGCCGATTTCGTGGTCCGATCGCAGTTCGCGCTCAAGACCGGCGCGGCCCTC
TRN  10010101100011001
//