EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06266 - HrpF)
FAM  PF06266
PID  HrpF
DES  HrpF protein
IPR  IPR009371
ANO  5
ALN  75
AID  0.472252
APH  (((P94765_ERWCH/1-75:0.46561,Q9FCZ3_ERWST/1-74:0.11878):0.07199,Q46623_ERWAM/1-74:0.03320):0.83578,O87439_PSESM/1-74:0.29146,O87462_PSESG/1-74:0.84110);
ATP  (((P94765_ERWCH/1-75,Q9FCZ3_ERWST/1-74),Q46623_ERWAM/1-74),O87439_PSESM/1-74,O87462_PSESG/1-74);
ATL  2.65785
DNO  5
DLN  225
DID  0.519011
DPH  (((Q9FCZ3_ERWST/1-74:0.15765,P94765_ERWCH/1-75:0.38698):0.08863,Q46623_ERWAM/1-74:0.04260):0.58640,O87439_PSESM/1-74:0.32365,O87462_PSESG/1-74:0.37768);
DTP  (((Q9FCZ3_ERWST/1-74,P94765_ERWCH/1-75),Q46623_ERWAM/1-74),O87439_PSESM/1-74,O87462_PSESG/1-74);
DTL  1.96359
RID  0.472252
RPH  (((P94765_ERWCH/1-75:0.46561,Q9FCZ3_ERWST/1-74:0.11878):0.07199,Q46623_ERWAM/1-74:0.03320):0.83578,O87439_PSESM/1-74:0.29146,O87462_PSESG/1-74:0.84110);
RTP  (((P94765_ERWCH/1-75,Q9FCZ3_ERWST/1-74),Q46623_ERWAM/1-74),O87439_PSESM/1-74,O87462_PSESG/1-74);
RTL  2.65785
LNK  O87439_PSESM/1-74:O87439:AF232004
LNK  O87462_PSESG/1-74:O87462:AF069651
LNK  P94765_ERWCH/1-75:P94765:AF501263
LNK  Q46623_ERWAM/1-74:Q46623:U56662
LNK  Q9FCZ3_ERWST/1-74:Q9FCZ3:AF282857
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FCZ3_ERWST/1-74
ASQ  MSSLSSIQRRLDSQFERAKNQLDEATMNASEG-YSQADSFAFFEASMGLSSASWAATQELTVKHGLIKALINEIN
DSQ  ATGTCATCACTGAGTTCGATTCAGCGGCGTTTAGACAGTCAGTTTGAACGTGCGAAAAACCAGCTTGACGAAGCCACCATGAATGCCAGTGAGGGA---TATAGTCAAGCTGACAGTTTTGCCTTTTTTGAAGCCAGCATGGGCCTTTCCAGTGCCAGTTGGGCAGCCACGCAAGAATTGACCGTCAAACATGGTTTAATTAAAGCCCTCATCAATGAGATCAAC
TRN  11011101101011000
NAM  Q46623_ERWAM/1-74
ASQ  MSSISALQRRLDSQFDKAQTQLDDATLDASEG-YSQEDSFAFFEASMGLSNASWAASQELTVKHGLAKAIINEIN
DSQ  ATGTCATCAATCAGCGCGCTCCAGCGCCGCCTGGACAGTCAGTTTGATAAAGCACAAACCCAACTGGACGATGCCACCTTGGATGCCAGTGAAGGC---TACAGCCAGGAGGACAGTTTTGCCTTCTTTGAAGCCAGTATGGGACTTTCCAACGCCAGCTGGGCTGCGAGCCAGGAGCTGACGGTTAAACACGGGCTTGCCAAAGCCATCATCAATGAGATCAAC
TRN  11011101101011001
NAM  P94765_ERWCH/1-75
ASQ  MSSSSPIQRRLDGAFVDAQSRLDEMAQSLSEGEVSMADSYAFYEASMDYSNANWAAGQMLSVKHGLAKAIINDFN
DSQ  ATGTCTTCATCTTCACCTATTCAGCGTCGGCTGGACGGCGCATTTGTCGATGCTCAATCCCGGCTCGACGAGATGGCGCAATCTCTCTCGGAAGGGGAGGTTAGCATGGCGGATAGCTATGCGTTTTATGAAGCCAGTATGGACTATTCCAATGCCAACTGGGCTGCCGGGCAGATGCTGAGCGTCAAGCATGGCTTGGCGAAGGCCATCATCAATGACTTCAAC
TRN  11011111101111101
NAM  O87462_PSESG/1-74
ASQ  MISFKSLQNNLDSTLNRALSDVDDVLEG-GNGHFTADDIDAFGEASQQAAVSSNIADQCQQAGYKMTKNVIDGFQ
DSQ  ATGATAAGTTTCAAATCTCTGCAAAATAACCTCGACAGCACGCTGAATCGCGCCTTGTCCGACGTGGATGACGTGCTTGAGGGT---GGCAACGGACATTTCACTGCCGATGACATTGATGCCTTCGGTGAGGCAAGTCAGCAAGCCGCTGTCAGTTCCAACATCGCTGACCAGTGCCAGCAAGCCGGCTACAAAATGACCAAAAATGTCATCGATGGATTTCAG
TRN  10010101100011011
NAM  O87439_PSESM/1-74
ASQ  MISFNSLQRHLDNSVSRAHTNMDQAAMEASES-GTVEDLQAFTMSQQQVDVAGIAVNECLRAKHGINKAVIDGIQ
DSQ  ATGATCAGTTTCAACAGCTTGCAACGCCATCTCGACAATTCGGTGAGCCGTGCTCACACCAACATGGACCAGGCAGCGATGGAAGCCTCCGAGAGT---GGCACCGTCGAAGACCTGCAGGCATTCACGATGTCCCAGCAGCAGGTCGATGTCGCCGGTATTGCCGTCAATGAATGCCTGCGTGCCAAGCACGGTATCAATAAAGCAGTCATCGATGGAATTCAG
TRN  11011101101011011
//