EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06261 - LktC)
FAM  PF06261
PID  LktC
DES  Actinobacillus actinomycetemcomitans leukotoxin activator LktC
IPR  IPR009369
ANO  2
ALN  150
AID  0.802817
APH  (O50557_ACTAC/1-149:0.08218,O50555_ACTAC/1-150:0.13979);
ATP  (O50557_ACTAC/1-149,O50555_ACTAC/1-150);
ATL  0.22196
DNO  2
DLN  450
DID  0.899329
DPH  (O50557_ACTAC/1-149:0.06615,O50555_ACTAC/1-150:0.04511);
DTP  (O50557_ACTAC/1-149,O50555_ACTAC/1-150);
DTL  0.11126
RID  0.802817
RPH  (O50557_ACTAC/1-149:0.08218,O50555_ACTAC/1-150:0.13979);
RTP  (O50557_ACTAC/1-149,O50555_ACTAC/1-150);
RTL  0.22196
LNK  O50555_ACTAC/1-150:O50555:U51861
LNK  O50557_ACTAC/1-149:O50557:U51862
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O50557_ACTAC/1-149
ASQ  MSGTEYAPFYLRFIQFPNNEVSLCEYWQLVQNSVKKIRRITVIFAQIIGTFSEKAIWKYQGTFNDGILEDEVAK-DVSLTLRNSALLVASAIVIHFKSNFTNLLILSQITQYHSYYPVLKKSKYSPLYFSCLLRRRLTEFKITLLPLPWG
DSQ  ATGTCCGGTACAGAATATGCTCCATTTTATCTCCGTTTTATTCAGTTCCCAAATAATGAAGTTTCACTTTGTGAATACTGGCAACTTGTTCAGAATTCTGTAAAAAAGATCAGAAGAATAACGGTAATATTCGCACAAATCATTGGCACTTTCAGCGAAAAAGCTATTTGGAAATATCAAGGTACTTTTAATGATGGCATACTGGAAGATGAAGTAGCTAAA---GACGTTTCCCTTACTTTAAGAAATAGTGCCTTACTTGTCGCAAGTGCCATAGTTATCCATTTTAAATCTAATTTTACCAACCTTCTCATACTGTCACAGATTACGCAATATCATAGCTATTACCCTGTACTTAAAAAAAGTAAATACTCCCCTCTCTACTTCTCTTGCTTATTACGCAGACGATTGACTGAATTTAAAATCACCCTTCTACCGTTGCCATGGGGC
TRN  10010101100011000
NAM  O50555_ACTAC/1-150
ASQ  MSSTEYAPFYLRFIQFPSNEVLLYEYWKLVQNFVQKVSKITVRLAQIVGILGEKTIWKYQSTFNDGMLEGEVAKQEVSLTLRNSALLVASAIVIHFKSNFTNLLILSQITQYCRHRPKSKKSKYFPLYLSCLLRRRLTEFKITLLPLPWG
DSQ  ATGTCCAGTACAGAATATGCTCCATTTTATCTCCGTTTTATTCAGTTCCCAAGTAATGAAGTTTTACTCTATGAATACTGGAAACTTGTTCAGAATTTTGTACAAAAGGTTAGTAAAATAACGGTAAGATTAGCACAAATCGTTGGCATTCTCGGCGAAAAAACTATTTGGAAATACCAAAGTACTTTTAATGATGGCATGCTGGAAGGTGAGGTAGCTAAACAAGAAGTTTCCCTCACTTTAAGAAATAGTGCTTTACTTGTCGCAAGTGCCATAGTTATCCACTTTAAATCTAATTTTACCAACCTTCTTATACTGTCACAGATTACACAATATTGTAGACATCGCCCTAAATCTAAAAAAAGTAAATACTTCCCCCTCTACCTCTCTTGCTTATTACGCAGACGATTAACTGAATTTAAAATTACCCTTCTACCGTTGCCATGGGGC
TRN  10010101100011000
//