EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06235 - NAD4L)
FAM  PF06235
PID  NAD4L
DES  NADH dehydrogenase subunit 4L (NAD4L)
IPR  IPR009356
ANO  6
ALN  86
AID  0.46368
APH  ((((Q9B8W8_9CEST/1-86:0.15652,Q953M9_ECHGR/1-86:0.23310):0.11270,Q958I7_HYMDI/1-86:0.13692):0.49262,Q9B8V0_9TREM/2-87:1.69951):0.04283,Q9GA65_FASHE/5-90:0.29349,Q9MLH9_9TREM/1-85:0.22974);
ATP  ((((Q9B8W8_9CEST/1-86,Q953M9_ECHGR/1-86),Q958I7_HYMDI/1-86),Q9B8V0_9TREM/2-87),Q9GA65_FASHE/5-90,Q9MLH9_9TREM/1-85);
ATL  3.39748
DNO  6
DLN  258
DID  0.599623
DPH  (Q9GA65_FASHE/5-90:0.13130,(((Q958I7_HYMDI/1-86:0.16508,Q953M9_ECHGR/1-86:0.20681):0.06432,Q9B8W8_9CEST/1-86:0.07790):0.19751,Q9B8V0_9TREM/2-87:0.63863):0.14983,Q9MLH9_9TREM/1-85:0.33044);
DTP  (Q9GA65_FASHE/5-90,(((Q958I7_HYMDI/1-86,Q953M9_ECHGR/1-86),Q9B8W8_9CEST/1-86),Q9B8V0_9TREM/2-87),Q9MLH9_9TREM/1-85);
DTL  1.96182
RID  0.46368
RPH  ((((Q9B8W8_9CEST/1-86:0.15652,Q953M9_ECHGR/1-86:0.23310):0.11270,Q958I7_HYMDI/1-86:0.13692):0.49262,Q9B8V0_9TREM/2-87:1.69951):0.04283,Q9GA65_FASHE/5-90:0.29349,Q9MLH9_9TREM/1-85:0.22974);
RTP  ((((Q9B8W8_9CEST/1-86,Q953M9_ECHGR/1-86),Q958I7_HYMDI/1-86),Q9B8V0_9TREM/2-87),Q9GA65_FASHE/5-90,Q9MLH9_9TREM/1-85);
RTL  3.39748
LNK  Q953M9_ECHGR/1-86:Q953M9:AF346403
LNK  Q958I7_HYMDI/1-86:Q958I7:AF314223
LNK  Q9B8V0_9TREM/2-87:Q9B8V0:AF217449
LNK  Q9B8W8_9CEST/1-86:Q9B8W8:AF216699
LNK  Q9GA65_FASHE/5-90:Q9GA65:AF216697
LNK  Q9MLH9_9TREM/1-85:Q9MLH9:AF219379
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9MLH9_9TREM/1-85
ASQ  -MCVLLVGSFVVLCGFVLSLSRFLNCLIVVENFNVLLLFSAIFQQWGESHILFIALMVIFTVEVVLGLVVLTRLWDLGSLIGRVGW
DSQ  ---GTGTGTGTCTTGTTGGTGGGGAGTTTTGTAGTGTTGTGTGGGTTTGTTCTGTCCCTTTCTCGCTTTTTGAACTGTCTGATAGTTGTCGAGAACTTTAATGTTCTGTTGCTCTTCTCGGCGATTTTTCAACAATGGGGGGAGAGGCATATTCTGTTCATTGCTTTGATGGTGATTTTCACCGTTGAGGTTGTTCTAGGTTTGGTGGTGCTTACTCGGCTATGGGATTTGGGAAGTTTGATCGGGCGAGTTGGTTGG
TRN  00000010000100000
NAM  Q9GA65_FASHE/5-90
ASQ  LVSFLYVGVLVIVFGFFLSLGRLLNCLIVVENLNVLLLFVCLLGQWEEFRIIFIALMVIFTIEVTLGLVVLTRLWDFSSLIGTVGV
DSQ  TTGGTTAGGTTTTTATATGTTGGTGTTTTAGTGATTGTTTTTGGGTTTTTTCTGTCTTTAGGTCGTTTGTTGAATTGTTTGATTGTTGTTGAGAATCTTAATGTGTTGTTGTTGTTTGTTTGTCTTTTAGGTCAGTGAGAAGAATTTCGTATTATTTTCATTGCTTTGATGGTGATTTTTACTATTGAGGTTACTTTGGGATTGGTTGTTTTGACTCGTTTGTGGGATTTCAGAAGTTTGATTGGTACTGTTGGTGTT
TRN  00001010000100100
NAM  Q9B8W8_9CEST/1-86
ASQ  MVTLFLVFSSVIIISFFLSITRFLNALIILENFNVLLLLFCLIVSTNDSHIIFIVMMIISTIEVIVGLVVLTRVWECSSSLELVDL
DSQ  ATGGTTACTTTATTTTTGGTTTTTAGTTCTGTAATAATTATTAGATTTTTTTTATCTATTACTCGATTTTTGAATGCGTTAATTATATTAGAGAATTTTAATGTGTTATTATTGTTATTTTGTTTAATAGTTTCTACTAATGATAGTCATATTATTTTCATAGTGATGATGATTATTTCTACTATAGAGGTAATTGTGGGATTAGTTGTGTTAACTCGTGTGTGAGAATGTTCATCTTCTTTAGAGTTAGTTGATTTA
TRN  00000010000100000
NAM  Q953M9_ECHGR/1-86
ASQ  MVTLFLLFSFVIMVSYFLAVGRFLNSLIILENFNVLILLFCLLYSSLDSHVIFIVFMVVSTVEIVISLTVLTRVWECSSCLELVDF
DSQ  GTGGTGACTTTATTTTTATTATTTAGTTTTGTAATTATGGTTAGTTATTTTTTAGCTGTAGGACGTTTTTTGAATAGTTTGATTATTCTGGAAAAATTTAACGTGTTAATTCTTTTATTTTGTTTGCTGTATTCTTCTCTAGATAGTCATGTTATTTTTATAGTATTTATGGTAGTTTCTACTGTGGAGATTGTTATTAGGTTGACTGTGTTAACTCGGGTATGGGAATGTTCATCTTGTTTAGAATTGGTTGATTTT
TRN  00000010000100000
NAM  Q958I7_HYMDI/1-86
ASQ  MVTIFLILFFTIVFSFFLSFSRFLNCLIILENFNVLLLLFCLMYSSLESHMLFIILIIISTVEVIIGLVVLTRVWECSSTIELVSF
DSQ  ATGGTTACTATTTTTTTGATTTTATTTTTTACAATAGTTTTTAGTTTTTTTTTATCTTTTAGTCGTTTTTTGAAATGTTTGATTATACTGGAAAAATTTAATGTGTTGTTATTACTATTTTGTTTAATGTATAGTAGTCTAGAGAGTCATATGCTTTTTATAATTTTGATAATTATTTCTACTGTAGAAGTAATTATTGGATTGGTTGTATTGACTCGTGTTTGGGAATGTTCAAGTACTATAGAATTAGTTTCTTTT
TRN  00000010000100000
NAM  Q9B8V0_9TREM/2-87
ASQ  LIVMLLCGGGLVLISLLICGHHLFNYLIVLESYNILLLLVCLLMNINDCHIVFISMMALFVLEVSVMLIVVGTNICQGSLRISIGF
DSQ  TTAATTGTTATGTTATTATGTGGAGGTGGTTTAGTATTAATAAGTTTATTGATATGTGGTCATCATTTGTTTAAATATTTAATAGTTTTAGAGAGTTATAAAATTCTATTGTTGTTAGTTTGTTTATTAATGAAAATTAATGATTGTCATATAGTATTCATTTCGATGATGGCTTTATTTGTTTTAGAAGTTTCAGTAATGTTGATAGTTGTTGGTACTAAAATATGTCAGGGTTCTTTGCGTATTTCTATTGGTTTT
TRN  00000010000100000
//