EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06234 - TmoB)
FAM  PF06234
PID  TmoB
DES  Toluene-4-monooxygenase system protein B (TmoB)
IPR  IPR009355
ANO  6
ALN  88
AID  0.43222
APH  (((TMOB_PSEME/1-83:0.48310,O87799_PSEST/1-85:0.20567):0.20067,(Q9RBP1_9NOCA/1-88:0.51102,Q9ZET6_XANP2/1-88:0.13287):0.99948):0.15534,P95409_PSEAE/1-85:0.17436,Q51940_BURPI/1-85:0.23456);
ATP  (((TMOB_PSEME/1-83,O87799_PSEST/1-85),(Q9RBP1_9NOCA/1-88,Q9ZET6_XANP2/1-88)),P95409_PSEAE/1-85,Q51940_BURPI/1-85);
ATL  3.09707
DNO  6
DLN  264
DID  0.512004
DPH  ((Q9RBP1_9NOCA/1-88:0.46246,Q9ZET6_XANP2/1-88:0.15019):0.38768,(P95409_PSEAE/1-85:0.19284,Q51940_BURPI/1-85:0.20590):0.09130,(O87799_PSEST/1-85:0.31368,TMOB_PSEME/1-83:0.38413):0.18030);
DTP  ((Q9RBP1_9NOCA/1-88,Q9ZET6_XANP2/1-88),(P95409_PSEAE/1-85,Q51940_BURPI/1-85),(O87799_PSEST/1-85,TMOB_PSEME/1-83));
DTL  2.36848
RID  0.43222
RPH  (((TMOB_PSEME/1-83:0.48310,O87799_PSEST/1-85:0.20567):0.20067,(Q9RBP1_9NOCA/1-88:0.51102,Q9ZET6_XANP2/1-88:0.13287):0.99948):0.15534,P95409_PSEAE/1-85:0.17436,Q51940_BURPI/1-85:0.23456);
RTP  (((TMOB_PSEME/1-83,O87799_PSEST/1-85),(Q9RBP1_9NOCA/1-88,Q9ZET6_XANP2/1-88)),P95409_PSEAE/1-85,Q51940_BURPI/1-85);
RTL  3.09707
LNK  O87799_PSEST/1-85:O87799:AJ005663
LNK  P95409_PSEAE/1-85:P95409:D83068
LNK  Q51940_BURPI/1-85:Q51940:U04052
LNK  Q9RBP1_9NOCA/1-88:Q9RBP1:AJ249207
LNK  Q9ZET6_XANP2/1-88:Q9ZET6:AJ012090
LNK  TMOB_PSEME/1-83:Q00457:M65106
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZET6_XANP2/1-88
ASQ  MSLFPIVGRFVGDFVPHLVAVDTSDTIDQIAEKVAVHTVGRRLPPDPTATGYEVLLDGETLDGGATLEAIMTKREMLPLQWFDVRFKK
DSQ  ATGTCTTTGTTCCCCATCGTGGGCCGCTTCGTGGGGGATTTCGTCCCCCACCTGGTGGCGGTGGACACCTCTGACACCATCGATCAGATCGCCGAGAAGGTGGCGGTCCACACGGTCGGGCGGCGCTTGCCGCCCGATCCCACCGCCACCGGCTATGAGGTGCTCCTCGACGGCGAGACCCTGGACGGGGGCGCCACCCTGGAGGCCATCATGACCAAGCGCGAGATGCTGCCCCTGCAGTGGTTCGACGTGAGGTTCAAGAAG
TRN  10010101100011011
NAM  Q9RBP1_9NOCA/1-88
ASQ  MAPFPITGRFIGDFVPHLVAVDTDDTWDQIACKIAVHAVGRRIPEPEVSPGYDVLLDGTVMTPDETLGDLLGTRSIPPLQWIDVRFRE
DSQ  ATGGCACCCTTTCCTATCACTGGCCGGTTCATCGGTGATTTCGTTCCACATCTCGTTGCCGTGGATACCGACGACACATGGGATCAAATTGCCTGCAAGATAGCAGTGCATGCGGTAGGGCGTCGTATCCCGGAGCCTGAAGTGAGCCCGGGATACGACGTACTTCTCGATGGAACTGTGATGACACCCGACGAGACCCTGGGGGATTTGTTGGGCACACGATCCATTCCGCCGCTGCAATGGATCGACGTCCGCTTTCGTGAG
TRN  10010111100111011
NAM  Q51940_BURPI/1-85
ASQ  MALFPVISNFQYDFVLQLVAVDTENTIDEVAAAAAHHSVGRRVAPQP---GKIVRVRRQGGEQFYPRNARLADTDIKPMEALEFIFCD
DSQ  ATGGCACTTTTTCCTGTGATTTCCAACTTTCAGTACGACTTCGTGCTGCAACTCGTCGCGGTGGATACGGAAAACACCATCGACGAGGTGGCCGCAGCAGCGGCACACCACTCGGTGGGACGCCGCGTGGCACCGCAGCCC---------GGCAAGATCGTCAGGGTGCGGCGCCAGGGCGGCGAGCAGTTCTACCCGCGTAACGCCAGGCTGGCCGACACCGACATCAAGCCGATGGAAGCGCTCGAATTCATTTTTTGCGAT
TRN  10010101100011011
NAM  P95409_PSEAE/1-85
ASQ  MALIPLISNFEGDFVLQLVPVDTENTMDEVAAAAAHHSVGRRVKPRP---GHVIRVRKQGSEELIPRTAKISEAGIKPMECLEFVWEA
DSQ  ATGGCTCTGATTCCTTTGATTTCCAATTTTGAAGGCGATTTCGTGTTGCAACTGGTGCCGGTGGATACCGAAAACACCATGGACGAGGTAGCCGCTGCTGCTGCCCATCACTCGGTGGGGCGGCGCGTGAAGCCCCGGCCG---------GGACACGTGATTCGCGTGCGTAAGCAGGGTAGCGAGGAACTGATCCCACGGACGGCCAAGATCTCCGAGGCTGGGATCAAGCCCATGGAGTGTCTCGAATTCGTCTGGGAAGCC
TRN  11011111101111111
NAM  TMOB_PSEME/1-83
ASQ  -SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPRE----GVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
DSQ  ---TCGGCATTTCCAGTTCACGCAGCGTTTGAAAAAGATTTCTTGGTTCAACTGGTAGTGGTGGATTTAAATGATTCCATGGACCAGGTAGCGGAGAAAGTTGCCTACCATTGTGTTAATCGTCGTGTTGCTCCTCGTGAA------------GGTGTCATGCGGGTTCGAAAGCATAGATCAACTGAGCTATTTCCACGGGATATGACCATAGCTGAGAGCGGCCTTAACCCAACTGAAGTGATCGATGTGGTATTCGAGGAG
TRN  10010101100011000
NAM  O87799_PSEST/1-85
ASQ  MATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQP---EKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
DSQ  ATGGCGACGTTCCCGATTATGTCTAATTTTGAGCGTGATTTTGTTATCCAGTTGGTGCCCGTTGACACGGAGGATACGATGGATCAGGTAGCAGAAAAATGTGCCTACCACTCCATTAATCGCAGGGTACATCCGCAACCG---------GAAAAGATTTTACGTGTTCGCCGGCACGAGGATGGGACGCTGTTTCCTCGAGGCATGATCGTATCGGATGCGGGGCTTCGGCCTACCGAAACACTCGATATTATTTTTATGGAT
TRN  10010101100011010
//