EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06232 - ATS3)
FAM  PF06232
PID  ATS3
DES  Embryo-specific protein 3, (ATS3)
IPR  IPR010417
ANO  5
ALN  140
AID  0.485363
APH  ((Q9LVB6_ARATH/31-158:0.16914,(O81271_ARATH/17-148:0.35882,Q9LVB5_ARATH/23-152:0.25279):0.31800):0.23190,O80821_ARATH/31-158:0.28262,Q94E65_ORYSA/44-181:0.62939);
ATP  ((Q9LVB6_ARATH/31-158,(O81271_ARATH/17-148,Q9LVB5_ARATH/23-152)),O80821_ARATH/31-158,Q94E65_ORYSA/44-181);
ATL  2.24266
DNO  5
DLN  420
DID  0.5674
DPH  ((Q9LVB6_ARATH/31-158:0.25697,(O81271_ARATH/17-148:0.18629,Q9LVB5_ARATH/23-152:0.22184):0.17908):0.12054,O80821_ARATH/31-158:0.22031,Q94E65_ORYSA/44-181:0.47768);
DTP  ((Q9LVB6_ARATH/31-158,(O81271_ARATH/17-148,Q9LVB5_ARATH/23-152)),O80821_ARATH/31-158,Q94E65_ORYSA/44-181);
DTL  1.66271
RID  0.485363
RPH  ((Q9LVB6_ARATH/31-158:0.16914,(O81271_ARATH/17-148:0.35882,Q9LVB5_ARATH/23-152:0.25279):0.31800):0.23190,O80821_ARATH/31-158:0.28262,Q94E65_ORYSA/44-181:0.62939);
RTP  ((Q9LVB6_ARATH/31-158,(O81271_ARATH/17-148,Q9LVB5_ARATH/23-152)),O80821_ARATH/31-158,Q94E65_ORYSA/44-181);
RTL  2.24266
LNK  O80821_ARATH/31-158:O80821:AC004625
LNK  O81271_ARATH/17-148:O81271:AF067858
LNK  Q94E65_ORYSA/44-181:Q94E65:AP003215
LNK  Q9LVB5_ARATH/23-152:Q9LVB5:AB019235
LNK  Q9LVB6_ARATH/31-158:Q9LVB6:AB019235
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q94E65_ORYSA/44-181
ASQ  QPAGTLLQPALAADLAARTCWYTVQIKTSCASPWRTSDAVSLAFGDAYRNEVYAARLAGSSSSPQPSSSAAFERCATDTFRVGGPCGYG-VCYLYLRRSGRDGWTPQWVRVYEPTSDTPSTFYYGDPLPN-AVWYGFNRC
DSQ  CAGCCAGCCGGCACGCTCCTCCAGCCCGCTCTCGCCGCGGACCTCGCGGCGCGGACGTGCTGGTACACGGTGCAGATCAAGACGAGCTGCGCGTCGCCGTGGCGCACGTCGGACGCGGTCAGCCTCGCGTTCGGGGACGCCTACCGCAACGAGGTCTACGCGGCGCGGCTGGCCGGCTCCTCCTCCTCGCCGCAGCCGTCGTCGTCGGCCGCGTTCGAGCGGTGCGCCACCGACACGTTCCGCGTGGGGGGCCCCTGCGGCTACGGC---GTCTGCTACCTCTACCTCCGCCGCTCCGGCCGCGACGGCTGGACGCCGCAGTGGGTCAGGGTCTACGAGCCCACCTCCGACACCCCCTCCACCTTCTACTACGGCGACCCCCTCCCCAAC---GCCGTCTGGTACGGCTTCAACCGCTGC
TRN  10010101100011011
NAM  Q9LVB6_ARATH/31-158
ASQ  HVAESFNVSLIQKLG--NTCAYTVIISTSCSSTRYTRDQISVAFGDGYGNQIYAPRLDDP-------STKTFEQCSSDTFQINGPCTYQ-ICYVYLYRSGPDGWIPNTVKIYSHGSKAV-TFPYNTYVPE-SVWYGFNYC
DSQ  CACGTCGCTGAATCATTCAACGTTAGCCTCATCCAGAAATTGGGG------AATACTTGTGCTTACACAGTGATCATCTCGACGAGCTGTTCGTCGACTAGGTACACGCGCGATCAGATCAGCGTCGCTTTCGGCGATGGCTATGGTAACCAGATATACGCACCAAGGCTTGATGATCCA---------------------TCTACAAAAACGTTTGAGCAATGTTCATCAGATACATTTCAGATAAACGGACCATGTACATACCAG---ATATGCTATGTATATCTCTACAGGTCTGGTCCAGATGGTTGGATCCCAAACACTGTAAAGATATATAGCCATGGCTCTAAAGCGGTC---ACCTTCCCATATAACACATATGTTCCTGAG---AGTGTATGGTATGGTTTCAATTACTGC
TRN  10010101110011001
NAM  O80821_ARATH/31-158
ASQ  LPIDSFIPKPKLENA--AACSYTVIIKTSCSSVSYTRDKISISFGDVYGNEVYVKRLDDP-------SSRTFEKCSSDTYKISGPCMRD-VCYLYLLRQGSDGWKPENVKIYGSSIRSV-TFYYNLFLPN-SVWYGFNVC
DSQ  CTTCCGATTGATTCATTTATTCCTAAACCAAAGCTAGAGAATGCG------GCTGCGTGTTCTTACACGGTGATCATTAAGACAAGCTGTTCCTCTGTGTCTTACACTAGAGATAAGATCAGTATATCGTTTGGTGATGTCTACGGCAACGAGGTGTATGTGAAGAGACTAGACGATCCA---------------------TCGTCGAGGACGTTCGAAAAGTGTTCATCAGACACATACAAGATATCGGGACCGTGTATGCGCGAC---GTTTGTTATCTCTACCTCCTCAGGCAAGGATCCGACGGCTGGAAACCAGAGAATGTTAAGATCTACGGCTCATCCATCAGATCAGTC---ACTTTCTACTACAACCTTTTCTTGCCTAAC---TCTGTTTGGTACGGCTTTAATGTCTGC
TRN  10010101110011001
NAM  O81271_ARATH/17-148
ASQ  FVTHAFDLSIIQMQQ--GTCPYTVVVMTSCLSPESTRDQISIVFGDADGNKVYAPKLGGS-----VRGPGGLGKCSTNTFQVRGQCLNDPICSLYINRNGPDGWVPESIEIYSEGSKSV-KFDFSKSVPQLNTWYGHNNC
DSQ  TTCGTTACGCATGCATTCGACCTCAGCATCATCCAGATGCAACAG------GGAACATGTCCGTACACGGTGGTTGTCATGACAAGCTGTCTTTCTCCGGAGTCGACAAGAGATCAGATCAGCATTGTTTTTGGCGATGCCGACGGTAACAAGGTGTATGCACCGAAACTAGGGGGTTCG---------------GTAAGAGGACCAGGGGGTTTGGGAAAGTGTTCAACGAACACATTCCAAGTCAGAGGTCAATGTTTAAATGACCCTATCTGCTCTCTCTATATCAACCGGAATGGACCCGATGGCTGGGTCCCGGAGTCCATTGAGATCTACTCAGAAGGTTCAAAGTCCGTT---AAATTCGATTTCAGCAAGAGCGTCCCTCAACTAAACACTTGGTACGGCCACAACAACTGC
TRN  10010101110011000
NAM  Q9LVB5_ARATH/23-152
ASQ  LTFEPLISSLDLHEE--ESCPYTVIVTTSCFSPDWSRDQVTIALGDADDNQVVAPRLDKP-----LSGGGGFEKCSSDTFQVKGKCLNT-ICSVYIYRSGTDGWIPETVEIYKEGSKSV-KFDFNKNVPE-NIWYGNNYC
DSQ  CTAACCTTCGAGCCACTAATCTCTTCTCTTGATCTTCATGAAGAA------GAAAGCTGCCCTTACACTGTAATTGTTACCACAAGCTGTTTCTCTCCTGATTGGTCTAGAGATCAGGTCACTATCGCTTTGGGTGACGCCGACGATAACCAGGTGGTCGCACCGAGACTAGACAAACCG---------------CTAAGTGGAGGAGGTGGTTTTGAGAAATGTTCATCGGACACATTCCAAGTCAAAGGTAAATGTCTCAACACT---ATCTGCTCCGTCTACATCTACCGTTCCGGTACCGACGGCTGGATCCCGGAGACCGTCGAGATATACAAGGAAGGTTCCAAATCCGTG---AAATTCGATTTCAACAAGAACGTCCCTGAA---AACATTTGGTACGGAAACAACTATTGT
TRN  10010101110011001
//