EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06228 - DUF1008)
FAM  PF06228
PID  DUF1008
DES  Protein of unknown function (DUF1008)
IPR  IPR010413
ANO  9
ALN  142
AID  0.427593
APH  ((((((Q8EB66_SHEON/42-181:0.39766,Q9CNX4_PASMU/1-142:0.47142):0.07310,Q93SS9_PLESH/8-148:0.33691):0.10236,(Q8D3S1_VIBVU/23-162:0.14527,Q9KL40_VIBCH/49-188:0.16386):0.19766):0.33283,Q93SH2_BRAJA/24-162:0.48053):0.13073,Q8UCM1_AGRT5/31-169:0.75088):0.13617,O70017_SHIDY/21-157:0.35061,Q8ZJ43_YERPE/33-169:0.21222);
ATP  ((((((Q8EB66_SHEON/42-181,Q9CNX4_PASMU/1-142),Q93SS9_PLESH/8-148),(Q8D3S1_VIBVU/23-162,Q9KL40_VIBCH/49-188)),Q93SH2_BRAJA/24-162),Q8UCM1_AGRT5/31-169),O70017_SHIDY/21-157,Q8ZJ43_YERPE/33-169);
ATL  4.30049
DNO  9
DLN  426
DID  0.501632
DPH  (Q93SS9_PLESH/8-148:0.31787,Q9CNX4_PASMU/1-142:0.38119,((((Q8UCM1_AGRT5/31-169:0.43207,Q93SH2_BRAJA/24-162:0.34812):0.08928,(O70017_SHIDY/21-157:0.30720,Q8ZJ43_YERPE/33-169:0.28296):0.10697):0.30504,(Q8D3S1_VIBVU/23-162:0.20962,Q9KL40_VIBCH/49-188:0.17361):0.11072):0.05853,Q8EB66_SHEON/42-181:0.38976):0.08792);
DTP  (Q93SS9_PLESH/8-148,Q9CNX4_PASMU/1-142,((((Q8UCM1_AGRT5/31-169,Q93SH2_BRAJA/24-162),(O70017_SHIDY/21-157,Q8ZJ43_YERPE/33-169)),(Q8D3S1_VIBVU/23-162,Q9KL40_VIBCH/49-188)),Q8EB66_SHEON/42-181));
DTL  3.60086
RID  0.427593
RPH  ((((((Q8EB66_SHEON/42-181:0.39766,Q9CNX4_PASMU/1-142:0.47142):0.07310,Q93SS9_PLESH/8-148:0.33691):0.10236,(Q8D3S1_VIBVU/23-162:0.14527,Q9KL40_VIBCH/49-188:0.16386):0.19766):0.33283,Q93SH2_BRAJA/24-162:0.48053):0.13073,Q8UCM1_AGRT5/31-169:0.75088):0.13617,O70017_SHIDY/21-157:0.35061,Q8ZJ43_YERPE/33-169:0.21222);
RTP  ((((((Q8EB66_SHEON/42-181,Q9CNX4_PASMU/1-142),Q93SS9_PLESH/8-148),(Q8D3S1_VIBVU/23-162,Q9KL40_VIBCH/49-188)),Q93SH2_BRAJA/24-162),Q8UCM1_AGRT5/31-169),O70017_SHIDY/21-157,Q8ZJ43_YERPE/33-169);
RTL  4.30049
LNK  O70017_SHIDY/21-157:O70017:U64516
LNK  Q8D3S1_VIBVU/23-162:Q8D3S1:AE016813
LNK  Q8EB66_SHEON/42-181:Q8EB66:AE015801
LNK  Q8UCM1_AGRT5/31-169:Q8UCM1:AE009193
LNK  Q8ZJ43_YERPE/33-169:Q8ZJ43:AJ414141
LNK  Q93SH2_BRAJA/24-162:Q93SH2:AJ311165
LNK  Q93SS9_PLESH/8-148:Q93SS9:AY008342
LNK  Q9CNX4_PASMU/1-142:Q9CNX4:AE006065
LNK  Q9KL40_VIBCH/49-188:Q9KL40:AE004418
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KL40_VIBCH/49-188
ASQ  MAEQLNVTEFDIVHALPEEMVAVVDGSHAQTILESLPEWGPVTTIMTIAGSIFEVKAPFPKGKVARGYYNLMGRD-.GELHGHLKLENISHVALVSKPFMGRESHYFGFFTAQGENAFKIYLGRDEKRELIPEQVARFKAMQ
DSQ  ATGGCGGAGCAACTCAATGTCACTGAGTTTGACATCGTGCATGCTCTTCCTGAAGAGATGGTCGCGGTGGTGGATGGCTCTCATGCGCAAACCATTTTAGAAAGTCTGCCAGAATGGGGCCCTGTCACCACGATCATGACCATTGCGGGTTCTATTTTTGAAGTCAAAGCACCTTTTCCAAAAGGGAAAGTTGCACGGGGTTACTACAATTTAATGGGTCGTGAT---...GGGGAACTGCATGGCCATTTGAAACTCGAAAATATTAGCCATGTGGCTTTAGTCAGTAAGCCATTTATGGGACGCGAGAGCCACTACTTTGGCTTCTTTACCGCTCAAGGTGAAAACGCGTTCAAAATCTATCTGGGACGTGATGAGAAACGCGAATTGATCCCAGAGCAAGTCGCACGCTTTAAAGCAATGCAG
TRN  11011101101011010
NAM  Q8D3S1_VIBVU/23-162
ASQ  MAERLSVTELDIVQSLPQDMAVLVKGELAQSILENLVDFGPVTTIVHAFGSIFEVKAPFPKGKEARGYYNLMGKQ-.GELHGHLKLDNVVAVALVSKPFMGKESHYFGFFSASGENIFKIYLGRDEKRELFPEQVARFKSMQ
DSQ  ATGGCAGAACGCCTAAGCGTAACAGAGCTCGACATCGTTCAGTCTCTCCCTCAGGATATGGCTGTTTTGGTTAAGGGGGAGCTCGCGCAATCCATTTTAGAGAACCTGGTTGATTTTGGCCCAGTGACAACCATCGTACACGCGTTCGGCTCGATTTTTGAGGTGAAAGCGCCCTTCCCTAAAGGGAAAGAGGCCAGAGGCTATTACAACCTAATGGGCAAACAG---...GGTGAGCTGCACGGCCATCTCAAGTTGGACAATGTTGTTGCAGTGGCTTTAGTCAGCAAGCCATTCATGGGGAAAGAAAGCCACTACTTTGGTTTCTTTTCGGCCTCTGGTGAGAACATTTTTAAGATCTATTTGGGTCGCGATGAAAAACGTGAACTGTTCCCAGAGCAAGTGGCACGTTTTAAATCAATGCAA
TRN  10010101100011000
NAM  Q93SS9_PLESH/8-148
ASQ  LAARFGVSEYQLVAALPEAMAVMAHGSWAQSLLEELTDWGPLTTIVESEGSIFEFKGAFPVGKPGHGYFNLYSKEGtG-LHGHLLLSQVSHIALLAKPFMGKASYSLQFFAANGRTMFKVYLGRNKQRQLLPEQVALFEQLR
DSQ  TTAGCTGCGCGCTTTGGCGTCAGTGAATATCAGCTGGTTGCTGCACTGCCCGAAGCGATGGCGGTGATGGCGCATGGTAGCTGGGCGCAATCGCTGCTGGAAGAACTGACCGATTGGGGCCCACTGACCACCATCGTGGAGTCCGAAGGCAGCATTTTTGAATTCAAAGGGGCATTCCCTGTCGGTAAACCGGGGCACGGTTATTTCAACCTGTACTCCAAAGAGGGAaccGGT---TTGCATGGCCACCTGCTGTTATCGCAAGTGTCACACATCGCGTTGCTGGCCAAACCGTTTATGGGCAAGGCCAGTTATAGCCTGCAATTCTTTGCCGCTAACGGCCGGACTATGTTCAAAGTGTACTTAGGTCGAAACAAACAGCGTCAGCTGTTGCCGGAGCAAGTTGCGCTGTTTGAGCAGCTGCGT
TRN  11011101101011000
NAM  Q8EB66_SHEON/42-181
ASQ  LASELGIAELEVVTALPQAQRVFLPLAHMDELLQSLPEWGSLTTIVMLSGSVFEFKGDFPQGKFAHGYYNLYSKGD.G-LHGHLKLDGMRAIALISRPFRGSESHSINFFGPQGEVVFKVYLGRDKQRVLFPDQVRRFKALA
DSQ  TTGGCCAGTGAGTTAGGTATTGCCGAGCTTGAGGTGGTTACCGCCTTACCTCAAGCGCAGCGAGTGTTTTTACCTTTGGCCCATATGGACGAGTTACTACAAAGCTTACCCGAGTGGGGTTCGTTAACCACCATAGTGATGCTTTCGGGCAGTGTATTTGAATTTAAAGGCGATTTTCCCCAAGGAAAATTTGCCCATGGCTACTACAACCTCTACAGCAAAGGGGAT...GGC---TTACATGGTCATCTTAAATTGGATGGCATGCGGGCGATAGCCTTGATCAGCAGACCTTTTAGGGGCAGCGAGAGCCATTCAATTAACTTTTTTGGACCTCAGGGGGAGGTGGTATTTAAAGTTTATTTAGGACGTGACAAGCAAAGAGTGCTTTTTCCTGACCAAGTGCGCCGTTTTAAAGCGCTGGCC
TRN  10010101100011000
NAM  Q9CNX4_PASMU/1-142
ASQ  MASHFGKPEGEILCALPDEFVRVLPGERAEEVLAEISSWGIFTTIIEKEGSIFEIKDRFPTGMVGRGYYNLNMKDEeGTLHGHLKLDNISKIAFVSLPFRGKESYNIAFIANNGQTIFKVYLGRDAERQLFPEQVQKFKAFI
DSQ  ATGGCTTCGCACTTTGGCAAACCTGAAGGTGAAATTTTATGTGCTTTACCTGACGAGTTTGTTCGAGTGCTTCCTGGGGAACGTGCGGAGGAAGTGCTTGCTGAGATCAGTAGTTGGGGGATTTTCACGACCATTATTGAAAAAGAAGGATCGATTTTTGAAATTAAAGACCGTTTTCCGACCGGGATGGTTGGGCGTGGTTATTATAATTTGAATATGAAAGATGAAgaaGGCACACTTCATGGCCACCTTAAATTAGATAACATCAGCAAAATTGCCTTTGTGAGTTTACCGTTTCGCGGTAAAGAAAGTTATAACATCGCATTTATTGCGAATAATGGGCAAACTATTTTTAAAGTTTATTTGGGGCGCGATGCTGAGCGTCAACTATTTCCAGAACAAGTTCAAAAATTTAAAGCATTTATT
TRN  11011101111011010
NAM  Q93SH2_BRAJA/24-162
ASQ  VARGRNVTPRAVIEALPSSMVRMGGGEHFAAAMQDVAQWGEVTLIVHTDDAIFEFTGSIPAGEIGRGYFNLMQPKG.--LHGHLRHERCAGIAFVERPFMGKNSAFVAFVNADGGIMFKVFVGRDETRALRADQLARFRQLA
DSQ  GTCGCGCGGGGGCGCAATGTCACGCCACGTGCCGTGATCGAGGCACTGCCCTCGTCGATGGTGCGCATGGGAGGCGGCGAGCATTTTGCCGCCGCGATGCAGGACGTCGCACAATGGGGCGAGGTCACGCTGATCGTGCACACGGATGATGCGATCTTCGAGTTCACCGGATCAATTCCCGCGGGCGAGATCGGCCGCGGCTATTTCAACCTGATGCAGCCGAAGGGA...------TTGCATGGCCATCTGCGCCATGAGCGTTGCGCAGGCATCGCCTTCGTCGAGCGCCCCTTCATGGGCAAGAATTCGGCCTTCGTCGCCTTCGTCAATGCCGACGGTGGCATCATGTTCAAGGTCTTCGTCGGCCGCGACGAGACCCGGGCGCTGCGTGCGGACCAGCTCGCGCGGTTCCGCCAGCTCGCG
TRN  11011111101111101
NAM  Q8ZJ43_YERPE/33-169
ASQ  IAQDYQVSVLDVVRALPERVL--VGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSKQG.--LSGHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLAAFHQLA
DSQ  ATTGCACAGGATTACCAGGTCAGCGTACTTGATGTTGTGCGAGCCTTACCTGAACGAGTCTTG------GTAGGCGCAGAGCATTTTGATCGTATATGGGACAGCATGACCGAGTGGGGGGATGTCACGACCTTAGTCCATACCGCCGACGTGATTTTGGAACACAAAGGCCCACTACCGAGCGGGACTCACCGCCATGGCTATTTCAATTTACGCAGTAAACAAGGC...------CTCAGTGGCCATATCAGAGCACAAAATTGCCAGGCAATCGCCCTGCTGGAACGCCCATTTATGGGAATGGCAACAGCGTCAGTACAGTTTTTCAATCAACAGGGTGAAGTGATGTTTAAAGTCTATGTTGGCCGTGATGAACATCGTCAATTACGTGCTGATGGCCTTGCCGCATTCCATCAATTGGCT
TRN  10010101100011000
NAM  O70017_SHIDY/21-157
ASQ  VAEQYNTTLLEVVINLPFSTV--VPGDKFDTVWDTVCEWGNVTTLVHTADVILEFSGELPSGFHRHDYFNLRGKHG.--MSGHIKAENCTHIALIERKFMGMDTASILFFNKEGSAMLKIFLGRDDHRQLLSEQVSAFHTLA
DSQ  GTAGCCGAACAATACAACACCACACTGCTGGAGGTAGTGATAAATCTACCCTTCTCTACCGTA------GTGCCAGGCGATAAATTCGATACTGTCTGGGATACCGTCTGCGAATGGGGCAACGTCACCACGTTAGTACATACTGCCGATGTAATCCTCGAATTTAGCGGCGAACTGCCTTCGGGTTTCCATCGCCACGACTATTTCAACCTACGCGGAAAACACGGC...------ATGTCCGGGCATATCAAAGCAGAAAACTGCACGCATATTGCCTTAATCGAACGTAAATTTATGGGCATGGACACCGCGTCCATTCTCTTTTTCAACAAAGAAGGCAGCGCCATGCTGAAAATCTTCCTCGGCAGGGATGACCATCGTCAGCTCCTGAGCGAACAAGTCAGCGCCTTCCATACTCTGGCA
TRN  10010101100011010
NAM  Q8UCM1_AGRT5/31-169
ASQ  IAAKAEVAPAEILAILPQGAAVSAPADRFDAIWNEMRGWGEILMIVQTGDIVLEVPGHLPEGTESHGWFNIHGDSP.--IGGHIKKDNCAAITFVDRGFHGRRSCSVWFMNAAGGAMFKIFVRRDENKELLAGQLAKFEELR
DSQ  ATCGCCGCGAAGGCCGAGGTGGCGCCGGCCGAAATTCTGGCGATCCTGCCGCAAGGTGCCGCCGTTTCCGCGCCGGCCGACCGGTTCGACGCCATCTGGAACGAGATGCGCGGCTGGGGCGAAATCCTGATGATCGTGCAGACCGGCGATATCGTGCTGGAAGTGCCGGGCCACCTGCCGGAAGGCACTGAAAGCCACGGCTGGTTCAACATTCACGGCGACAGCCCC...------ATTGGCGGTCACATCAAGAAGGACAATTGCGCTGCGATCACCTTCGTCGATCGCGGCTTCCACGGCCGCCGCTCCTGCTCCGTCTGGTTCATGAATGCCGCCGGCGGCGCCATGTTCAAGATCTTCGTCCGCCGCGACGAGAACAAGGAACTGCTGGCCGGGCAACTGGCGAAGTTCGAAGAACTGCGG
TRN  11011111101111111
//