EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06206 - DUF1001)
FAM  PF06206
PID  DUF1001
DES  Protein of unknown function (DUF1001)
IPR  IPR010404
ANO  9
ALN  192
AID  0.374559
APH  (((((Q9S330_PROMA/6-189:0.79112,Q9ALZ7_FREDI/13-195:0.25636):0.23253,Q8YZ40_ANASP/4-194:1.14060):0.13719,(P74371_SYNY3/4-186:0.30890,(Q8DH04_SYNEL/4-186:0.28176,Q8YLF9_ANASP/4-186:0.14340):0.02909):0.13125):0.12628,Q98RP9_GUITH/32-217:0.86544):0.71099,YRPA_SYNPY/2-183:0.21090,YRPA_SYNPZ/3-184:0.18975);
ATP  (((((Q9S330_PROMA/6-189,Q9ALZ7_FREDI/13-195),Q8YZ40_ANASP/4-194),(P74371_SYNY3/4-186,(Q8DH04_SYNEL/4-186,Q8YLF9_ANASP/4-186))),Q98RP9_GUITH/32-217),YRPA_SYNPY/2-183,YRPA_SYNPZ/3-184);
ATL  5.55552
DNO  9
DLN  576
DID  0.46978
DPH  (((Q98RP9_GUITH/32-217:0.57744,(Q9S330_PROMA/6-189:0.51897,Q9ALZ7_FREDI/13-195:0.29781):0.07630):0.09899,((YRPA_SYNPY/2-183:0.25000,YRPA_SYNPZ/3-184:0.24829):0.43157,Q8YZ40_ANASP/4-194:0.66711):0.13083):0.08417,Q8YLF9_ANASP/4-186:0.20925,(P74371_SYNY3/4-186:0.30035,Q8DH04_SYNEL/4-186:0.23911):0.05712);
DTP  (((Q98RP9_GUITH/32-217,(Q9S330_PROMA/6-189,Q9ALZ7_FREDI/13-195)),((YRPA_SYNPY/2-183,YRPA_SYNPZ/3-184),Q8YZ40_ANASP/4-194)),Q8YLF9_ANASP/4-186,(P74371_SYNY3/4-186,Q8DH04_SYNEL/4-186));
DTL  4.18731
RID  0.374559
RPH  (((((Q9S330_PROMA/6-189:0.79112,Q9ALZ7_FREDI/13-195:0.25636):0.23253,Q8YZ40_ANASP/4-194:1.14060):0.13719,(P74371_SYNY3/4-186:0.30890,(Q8DH04_SYNEL/4-186:0.28176,Q8YLF9_ANASP/4-186:0.14340):0.02909):0.13125):0.12628,Q98RP9_GUITH/32-217:0.86544):0.71099,YRPA_SYNPY/2-183:0.21090,YRPA_SYNPZ/3-184:0.18975);
RTP  (((((Q9S330_PROMA/6-189,Q9ALZ7_FREDI/13-195),Q8YZ40_ANASP/4-194),(P74371_SYNY3/4-186,(Q8DH04_SYNEL/4-186,Q8YLF9_ANASP/4-186))),Q98RP9_GUITH/32-217),YRPA_SYNPY/2-183,YRPA_SYNPZ/3-184);
RTL  5.55552
LNK  P74371_SYNY3/4-186:P74371:BA000022
LNK  Q8DH04_SYNEL/4-186:Q8DH04:BA000039
LNK  Q8YLF9_ANASP/4-186:Q8YLF9:BA000019
LNK  Q8YZ40_ANASP/4-194:Q8YZ40:BA000019
LNK  Q98RP9_GUITH/32-217:Q98RP9:AF165818
LNK  Q9ALZ7_FREDI/13-195:Q9ALZ7:AF334109
LNK  Q9S330_PROMA/6-189:Q9S330:AJ001230
LNK  YRPA_SYNPY/2-183:Q02187:M95288
LNK  YRPA_SYNPZ/3-184:Q02426:M95289
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8YZ40_ANASP/4-194
ASQ  SPQLVNLGNYLAGEFDNREQALGEPIWFVHLRLWQRPVDLFSDDSITLFAEQANIVNLDRPYRQRILRLMPAPDSETGLYVQYYMPKNPSALIGAGRHPDLLKTLTPQQLELL-PGCVLSVSQQTVAPNSYQFTASPLPNTCCTFSYLENTVQVSLGFAVTETELHTYDKGIDQETGKATWGAIVGPYRYTK
DSQ  TCGCCCCAATTAGTTAACTTAGGTAATTACCTAGCTGGAGAATTTGACAACAGAGAACAAGCCTTAGGCGAGCCGATTTGGTTTGTTCACTTACGTCTATGGCAAAGACCTGTTGATTTGTTTTCCGACGATAGCATTACTCTGTTTGCCGAACAAGCCAACATTGTCAATCTAGACCGTCCTTATCGTCAACGTATTCTGCGGTTGATGCCTGCTCCTGACTCGGAAACTGGGCTATATGTACAGTACTATATGCCTAAAAATCCCAGTGCTTTAATTGGTGCAGGTCGTCACCCAGACTTACTCAAGACTTTAACCCCCCAGCAACTAGAACTACTT---CCTGGCTGTGTTCTCTCAGTTAGCCAGCAAACAGTTGCACCTAACAGCTATCAGTTTACTGCGTCCCCACTGCCAAATACTTGCTGTACTTTCAGTTATTTGGAGAACACTGTACAAGTTTCTTTAGGTTTTGCAGTCACAGAGACAGAACTGCACACCTATGATAAAGGAATTGACCAAGAGACAGGCAAGGCAACTTGGGGAGCAATTGTCGGCCCCTATCGCTACACTAAG
TRN  10010101100011000
NAM  Q8YLF9_ANASP/4-186
ASQ  STDIATLARWMAADFSNQAQAFENPPFYAHIRVCMRPLPWEVLSGVGFFVEQAYDYMLNDPYRLRVLKLMIVGDR---IHIENYTVKQEENFYGASRDLNRLQTLTSESLEKL-PGCNMIVEWTGN-----SFKGTVEPGKGCIVVRKGQKTYLDSEFEINEEKFISLDRGRDLETDAHIWGSVAGPFYFVR
DSQ  TCTACAGACATAGCCACCTTAGCACGCTGGATGGCAGCCGACTTTAGCAATCAAGCACAAGCTTTTGAAAACCCACCTTTCTACGCCCATATTCGTGTGTGTATGCGCCCCCTACCGTGGGAAGTATTGTCTGGAGTAGGTTTTTTCGTTGAACAAGCTTATGATTATATGCTCAATGATCCCTATCGTTTGCGGGTACTCAAGCTAATGATTGTAGGCGATCGC---------ATCCATATTGAAAATTATACAGTTAAGCAAGAAGAAAATTTTTACGGTGCATCCCGCGACCTTAATCGTCTGCAAACTTTAACTAGCGAATCTTTGGAAAAATTA---CCAGGCTGTAACATGATTGTTGAGTGGACTGGTAAC---------------AGCTTTAAAGGTACGGTAGAACCAGGAAAAGGTTGTATTGTTGTTCGCAAAGGTCAAAAGACCTACTTAGATAGCGAATTTGAAATTAACGAAGAGAAATTCATCAGTCTTGATAGAGGGCGAGATTTAGAAACAGATGCACACATCTGGGGTTCTGTTGCTGGCCCGTTCTATTTTGTACGT
TRN  10010101100011010
NAM  Q8DH04_SYNEL/4-186
ASQ  ATDVLTLGRWMAADFSNQAQAFENPPFYAHIRVCMRPLPRGVLEGIALYVEQAYDYLLSVPYRTRVLELMPANDH---IVIKNYVLKDEKRFFGAARDRQRLQAMTADDLELL-CGCNMLTYWTGH-----SFRGEVEPGKACKVVRKGRETYLDSTFEIDGDRFISHDRGRDPETDEHVWGSVAGPFHFVR
DSQ  GCAACCGATGTGTTGACTCTTGGCCGTTGGATGGCGGCGGATTTTAGTAACCAAGCGCAAGCCTTTGAGAATCCTCCCTTCTATGCCCATATTCGGGTCTGTATGCGCCCCCTTCCCAGGGGTGTTCTGGAGGGTATTGCCCTTTATGTGGAACAGGCCTATGACTATCTCCTCAGCGTTCCCTACCGTACACGGGTTTTGGAACTAATGCCCGCTAATGATCAC---------ATTGTCATTAAAAATTATGTGCTCAAGGATGAAAAACGCTTCTTTGGGGCAGCTCGCGATCGCCAGCGGCTTCAGGCCATGACAGCCGATGATCTTGAACTCCTC---TGTGGCTGCAATATGCTCACCTACTGGACAGGACAT---------------AGTTTTCGCGGTGAAGTGGAGCCGGGAAAAGCCTGTAAAGTCGTGCGTAAGGGACGGGAAACCTATCTCGATAGCACCTTTGAAATTGATGGCGATCGCTTCATTAGCCACGATCGCGGACGAGATCCAGAAACCGACGAGCACGTTTGGGGCTCCGTAGCCGGCCCCTTTCACTTTGTACGC
TRN  10010101100011011
NAM  P74371_SYNY3/4-186
ASQ  STDLSALARWMAADFSNQAQAFENPPFYAHIRVAIRPLDQAKFGDRLLFLEQAYDFMLQRPYRLRVLKLKVVEDH---IEIENFKVKDEEKFYGAARDLGKLAQLTPADLEPM-HGCDMIVEWTGT-----SFKGEVQPGRQCRVMRDGKETYLENSFEVSETGLISLDRGYDPETNERVWGSVAGAFHFVR
DSQ  TCCACTGATCTTTCCGCCCTAGCCCGTTGGATGGCCGCCGATTTTAGCAACCAGGCCCAAGCCTTTGAAAATCCCCCTTTTTATGCCCATATCCGGGTGGCCATTCGTCCCCTCGACCAAGCAAAGTTTGGCGATCGCCTTTTATTTTTAGAACAGGCCTACGACTTTATGTTGCAGAGGCCCTATCGCCTACGGGTGCTGAAATTAAAGGTGGTGGAAGATCAT---------ATTGAAATTGAAAACTTTAAAGTCAAAGATGAGGAAAAATTCTATGGTGCGGCCAGGGATTTGGGCAAACTAGCTCAACTAACCCCCGCTGATCTCGAACCCATG---CATGGCTGTGACATGATTGTGGAATGGACCGGCACT---------------AGCTTTAAAGGGGAAGTGCAACCGGGACGGCAATGCCGAGTGATGCGGGACGGCAAGGAAACCTATCTGGAAAATAGTTTTGAAGTGAGCGAAACGGGATTAATTAGCCTCGACCGTGGTTACGATCCAGAAACCAACGAACGGGTTTGGGGCTCCGTGGCCGGTGCTTTTCATTTTGTCCGG
TRN  10010101100011010
NAM  Q9ALZ7_FREDI/13-195
ASQ  SPNLITLARWMAGDFSNYQQAFENSKDYAHIHVFFRPLPFEFFSGIGLYSEQVYDYDLWRPYRQGVHRLIDKGDE---IYIENYSLKQALYYAGAARDLNILKTITPNCIERR-YHCSMIFKREGD-----KFIGGVEPGNLCLIEKNGCQTYLDSYVEITETTWVSLDKGMDVNTHQQVWGSTFGPLRFEK
DSQ  TCGCCTAATTTAATCACCCTGGCTCGTTGGATGGCAGGTGATTTCAGCAACTATCAACAGGCATTTGAAAATTCTAAAGATTACGCCCATATTCATGTTTTCTTTCGCCCATTACCGTTTGAATTCTTCTCAGGAATTGGGCTTTATTCAGAACAAGTATATGATTATGATTTGTGGCGACCTTATCGCCAGGGAGTCCATCGTCTTATCGATAAAGGCGATGAA---------ATTTATATCGAAAATTACAGCCTAAAACAAGCACTGTATTATGCAGGTGCAGCGCGAGACTTAAATATTCTCAAAACTATTACCCCAAATTGTATTGAACGCCGA---TATCATTGCTCAATGATTTTTAAACGCGAGGGAGAT---------------AAATTTATCGGCGGTGTTGAACCTGGAAACCTATGCTTAATTGAGAAAAATGGCTGCCAGACTTATCTAGATAGTTACGTTGAAATTACAGAAACCACTTGGGTAAGCCTAGATAAAGGTATGGATGTGAATACACACCAACAAGTTTGGGGATCTACCTTTGGGCCATTACGGTTTGAAAAG
TRN  11011101101011000
NAM  YRPA_SYNPZ/3-184
ASQ  TPNVRRFLNLLCGEYSNQQQAFDNPPLYAHIFLRYRSLPQ--LKPGSILLEQTYAVDPKNPYRLRMIRAEEQPSG--AIKLWNHTFQDPARFAGATFDPALRRSIQTPDLISL-DQCHYQVVEQSD-----GYHGAMEPGCQCIVRRDGKDTVLVSSFHLQGESLQTLDRGHDPITNERCWGSVAGPFRFKR
DSQ  ACACCCAACGTTCGGCGCTTTCTCAACCTGCTCTGCGGCGAGTACAGCAACCAGCAGCAAGCCTTCGACAATCCACCCCTCTACGCCCATATTTTTTTGAGGTATCGGTCTCTTCCGCAG------CTCAAGCCAGGGTCAATCCTGCTTGAGCAGACCTACGCGGTTGACCCCAAAAATCCCTACCGCCTGAGAATGATTCGCGCTGAAGAGCAACCATCCGGT------GCGATCAAACTCTGGAATCACACCTTCCAGGACCCTGCACGCTTCGCGGGCGCAACATTCGATCCTGCACTGCGCCGTTCCATCCAGACCCCGGATCTGATCAGCCTG---GACCAGTGCCACTACCAGGTGGTTGAACAGAGCGAC---------------GGCTACCACGGGGCCATGGAGCCGGGTTGCCAGTGCATCGTGCGACGCGATGGCAAAGACACCGTGCTGGTGAGCAGCTTTCACCTGCAAGGGGAATCGCTGCAGACCCTCGATCGCGGCCATGACCCCATCACCAATGAGCGCTGCTGGGGCTCTGTCGCCGGGCCGTTTCGGTTCAAGAGA
TRN  10010101100011001
NAM  YRPA_SYNPY/2-183
ASQ  TATIGHFLQNLCGEYSNQKQAFENPPLFAHIFLRYKPIEH--LQPGSILLEQTYAVDPKHPYRLRVIRAEELTSG--IIKLWNHTFKEPDRFSSATFDQDCREKIREEDLILL-DHCHYQVRQLDD-----GFHGELEPGCRCIVRRDGKETYLVSSFHLQGDELSTLDRGHDPQTHDRCWGSIAGKFHFQR
DSQ  ACAGCAACGATTGGACATTTTCTTCAAAATCTTTGTGGTGAATACAGCAACCAGAAACAGGCATTTGAAAACCCCCCGCTATTTGCACATATTTTTTTACGGTACAAGCCAATTGAGCAT------CTGCAACCCGGCTCAATCCTTCTCGAACAAACCTACGCAGTCGATCCAAAGCATCCCTACAGGCTTAGAGTGATTCGTGCCGAAGAATTGACGTCCGGA------ATCATCAAACTATGGAACCATACATTTAAAGAGCCAGACCGCTTTTCAAGCGCCACATTTGATCAGGATTGCAGAGAAAAGATCCGAGAAGAAGACCTCATTCTTCTC---GATCATTGCCATTATCAAGTACGTCAATTAGACGAT---------------GGATTTCATGGTGAACTCGAACCTGGATGTCGTTGCATCGTTCGTCGCGACGGGAAAGAGACCTATTTAGTGAGCAGCTTTCACCTCCAAGGTGATGAACTAAGCACGTTGGATCGTGGACATGACCCCCAAACACATGACCGATGCTGGGGATCGATTGCTGGTAAATTCCACTTTCAGCGC
TRN  10010101100011000
NAM  Q98RP9_GUITH/32-217
ASQ  QSLIEKFCSYIEGDWNNYDQNQKFPSLWSHIRVCFRTIPEENVGPNCFYVESAYDYMLDKPYKTVVVRIIEKDGF---IEMENFKLKSPEDFWFGSRDSSLLLNLKVDDLIKFNDDCNSIFYYKEN---EDIFYGITKPGKKCIIIRNGVKTYLDSRITLSKSKYTSWDIGRSYESELQLWGSTSGPFCFEK
DSQ  CAATCCTTAATTGAAAAATTTTGTAGTTATATCGAAGGCGATTGGAATAATTATGACCAAAATCAAAAGTTTCCATCATTGTGGTCACACATTCGTGTTTGTTTTAGGACTATTCCTGAAGAAAATGTAGGACCTAACTGTTTTTATGTAGAATCTGCCTATGATTACATGTTAGATAAACCTTACAAAACAGTTGTAGTCAGAATAATCGAAAAAGATGGATTT---------ATAGAAATGGAAAATTTTAAATTAAAAAGTCCTGAAGATTTTTGGTTTGGATCAAGAGATTCTTCTTTGTTGCTAAATTTAAAAGTAGATGATTTAATCAAATTTAATGATGATTGTAATTCAATATTTTATTATAAAGAAAAT---------GAAGATATTTTCTATGGTATTACTAAACCAGGAAAAAAATGTATAATAATAAGAAACGGTGTTAAAACATATCTAGATTCGCGTATAACACTTTCAAAAAGTAAATATACGAGCTGGGATATTGGTAGAAGCTATGAGAGTGAGTTACAACTATGGGGATCAACATCTGGGCCTTTTTGTTTTGAAAAA
TRN  10010101110011000
NAM  Q9S330_PROMA/6-189
ASQ  SQSKVLFAKILCGKYSNKDQAYHQPKLYAYMNIYFRPLPWNLFRGIGIYSEQSYDYSPWSPYRQAVHRLIVKENY---FILENYKIINAIRIAGAGFNLKLLDEIKKENLSIR-KSCEMHFQKTEE----GNYRGSLKKDEKFLIERGGIQTYLVSNVEFNKYNFNSTDQGLDIQTDSIVWGAKNGPLKFKK
DSQ  AGTCAATCAAAAGTACTTTTTGCCAAAATATTATGTGGAAAATATAGTAATAAGGATCAGGCATATCATCAGCCAAAATTATATGCCTATATGAATATATACTTTAGGCCTTTACCCTGGAATTTATTTAGAGGAATAGGTATTTATTCTGAACAAAGCTATGATTATTCACCTTGGTCACCATACAGGCAAGCGGTACATAGATTAATAGTTAAAGAAAATTAC---------TTTATACTAGAGAACTATAAAATAATAAATGCAATAAGAATTGCTGGAGCTGGCTTTAATTTAAAGCTATTAGATGAAATCAAAAAAGAAAATCTATCTATAAGA---AAAAGTTGTGAAATGCATTTCCAGAAAACTGAAGAA------------GGAAATTATAGAGGCAGTCTGAAGAAAGATGAAAAATTTTTAATTGAAAGAGGAGGGATACAAACTTATCTTGTTAGCAACGTTGAATTTAATAAATATAATTTCAATAGTACTGACCAAGGACTAGATATCCAAACAGACTCAATAGTATGGGGAGCCAAAAATGGACCTTTAAAGTTTAAGAAA
TRN  10010101100011000
//