EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06188 - HrpE)
FAM  PF06188
PID  HrpE
DES  HrpE protein
IPR  IPR009335
ANO  6
ALN  192
AID  0.36553
APH  (Q9FCZ4_ERWST/1-190:0.43618,Q46622_ERWAM/1-190:0.22423,(((O87461_PSESG/1-187:0.18154,Q52478_PSESM/1-187:0.09593):0.73777,Q93PY3_PSEFL/1-187:0.94808):0.44871,Q8KUL7_ERWCH/1-191:0.65320):0.14667);
ATP  (Q9FCZ4_ERWST/1-190,Q46622_ERWAM/1-190,(((O87461_PSESG/1-187,Q52478_PSESM/1-187),Q93PY3_PSEFL/1-187),Q8KUL7_ERWCH/1-191));
ATL  3.87231
DNO  6
DLN  576
DID  0.47681
DPH  (Q9FCZ4_ERWST/1-190:0.34299,Q46622_ERWAM/1-190:0.22031,(((O87461_PSESG/1-187:0.14656,Q52478_PSESM/1-187:0.13200):0.38271,Q93PY3_PSEFL/1-187:0.58880):0.26987,Q8KUL7_ERWCH/1-191:0.43495):0.11058);
DTP  (Q9FCZ4_ERWST/1-190,Q46622_ERWAM/1-190,(((O87461_PSESG/1-187,Q52478_PSESM/1-187),Q93PY3_PSEFL/1-187),Q8KUL7_ERWCH/1-191));
DTL  2.62877
RID  0.36553
RPH  (Q9FCZ4_ERWST/1-190:0.43618,Q46622_ERWAM/1-190:0.22423,(((O87461_PSESG/1-187:0.18154,Q52478_PSESM/1-187:0.09593):0.73777,Q93PY3_PSEFL/1-187:0.94808):0.44871,Q8KUL7_ERWCH/1-191:0.65320):0.14667);
RTP  (Q9FCZ4_ERWST/1-190,Q46622_ERWAM/1-190,(((O87461_PSESG/1-187,Q52478_PSESM/1-187),Q93PY3_PSEFL/1-187),Q8KUL7_ERWCH/1-191));
RTL  3.87231
LNK  O87461_PSESG/1-187:O87461:AF069651
LNK  Q46622_ERWAM/1-190:Q46622:U56662
LNK  Q52478_PSESM/1-187:Q52478:AF232004
LNK  Q8KUL7_ERWCH/1-191:Q8KUL7:AF448202
LNK  Q93PY3_PSEFL/1-187:Q93PY3:AF292566
LNK  Q9FCZ4_ERWST/1-190:Q9FCZ4:AF282857
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FCZ4_ERWST/1-190
ASQ  MLIRRHIDLVN-GKDDLAPVISRHQLAVQEQARTIIQEAHQRAEKIISAAEQEAEASSLLVRQRAEEAFWKRADTMFMHWQKQQQQWESDVLSVMDVVLEQALEQLLTEVPESQRLQGLLRQLLLEKTQTDKATLCCHPSQQASIATMLE-NYSHLNWQLQPEESLPPDSLKLVTPQGELYLDWQLASQQLK
DSQ  ATGTTGATACGCAGACATATTGATTTGGTGAAT---GGCAAAGATGATCTCGCACCAGTGATCTCCCGGCATCAGCTCGCCGTACAGGAGCAGGCCAGGACAATCATTCAGGAGGCCCATCAGCGAGCAGAAAAAATAATATCGGCCGCAGAACAGGAAGCGGAAGCTTCTTCACTGTTGGTTCGGCAGCGTGCAGAGGAAGCGTTCTGGAAGCGGGCAGACACGATGTTCATGCACTGGCAAAAGCAGCAACAGCAGTGGGAGTCAGACGTGCTCTCAGTGATGGACGTCGTACTGGAACAGGCCCTGGAACAGTTGCTGACGGAAGTCCCTGAATCACAGCGCCTCCAGGGACTGCTGCGACAATTGTTGCTTGAAAAAACGCAGACAGATAAGGCTACGCTGTGCTGCCATCCCTCTCAACAGGCGTCCATTGCGACAATGCTGGAA---AATTACTCACACCTGAACTGGCAACTGCAGCCAGAAGAGTCCCTTCCGCCAGACAGCCTGAAACTTGTTACACCACAGGGTGAATTATACCTCGACTGGCAGCTGGCTTCGCAGCAATTAAAA
TRN  10010101100011000
NAM  Q46622_ERWAM/1-190
ASQ  MLTRRRITLLN-AEADLAPVVSQAQLCIQQQGQDILEQARQQAQAMLEEAERQAEVEMLNAQQRAEQAFWQQADTLLQSWQQQYQQLEAQVLEVMDSVLTQALDQLLTDVPQTQRLAAILRQLLRAKTLTEQGSLYCHPAQHLEIADWLR-SHDHLAWQLQPDESLAQDSLKLVTANGELSLDWQQAVRQLL
DSQ  ATGTTGACGCGTAGAAGAATTACCCTGCTCAAC---GCGGAGGCCGATTTGGCACCCGTAGTCAGTCAGGCACAGCTGTGCATCCAGCAGCAGGGGCAGGATATCCTTGAGCAGGCCCGGCAACAGGCACAGGCGATGCTGGAAGAAGCGGAGCGGCAGGCAGAAGTCGAGATGTTGAATGCGCAGCAGCGCGCCGAGCAGGCTTTCTGGCAGCAGGCGGATACGCTGCTGCAAAGCTGGCAGCAGCAATATCAGCAGCTGGAAGCGCAGGTACTTGAAGTGATGGACAGCGTATTGACGCAGGCGCTTGACCAGTTGTTGACTGACGTTCCGCAAACACAGCGGCTGGCGGCGATATTACGTCAACTGCTACGGGCAAAAACCCTGACTGAACAGGGCAGCCTTTATTGTCATCCGGCACAGCATCTTGAGATCGCCGACTGGTTGCGC---AGTCATGACCACCTGGCCTGGCAGCTACAGCCGGATGAGTCGCTGGCGCAAGATAGCCTGAAACTGGTCACCGCTAATGGCGAATTGTCCCTTGACTGGCAGCAGGCAGTGCGCCAGTTACTC
TRN  10010101100011010
NAM  Q8KUL7_ERWCH/1-191
ASQ  MLTRRRLKLVAGTDVQEAELIRIEQLQQHQRGLAVIEEARQQADVLLDEARRQAHESIAVATGQAEQQFWRQADEILRGWQQEREQMESWLVSQCSQLLNDAMTQLLKTVPDAERYPALLRQLLRTQGGEGSGTLYCHPERQADVSAWLT-EHSHLGWKLSNDDALAQDTLKLITAQGVMTLSWQRAVEQLL
DSQ  ATGTTGACCAGACGGCGCCTAAAACTGGTAGCAGGAACGGATGTGCAGGAAGCGGAACTGATTCGGATTGAACAATTACAACAACATCAACGCGGCCTGGCGGTGATAGAAGAAGCGCGGCAACAGGCCGATGTGTTGCTTGACGAAGCACGCCGACAGGCGCATGAATCGATTGCCGTTGCCACCGGGCAGGCGGAGCAACAATTCTGGCGGCAGGCGGATGAGATATTGCGCGGCTGGCAACAGGAGCGCGAGCAAATGGAAAGCTGGCTGGTATCGCAATGCAGCCAGTTGCTGAACGATGCCATGACCCAACTTCTTAAAACCGTACCCGATGCAGAGCGTTACCCGGCGCTATTGCGCCAGTTATTGCGTACACAAGGCGGAGAAGGCAGCGGCACGCTGTATTGCCATCCCGAACGTCAGGCCGATGTGTCCGCCTGGCTGACC---GAACATAGCCACCTTGGCTGGAAATTGAGTAACGATGACGCGCTGGCGCAGGATACCCTGAAATTGATCACCGCACAGGGCGTTATGACCCTGAGCTGGCAGCGGGCGGTAGAACAGTTGCTG
TRN  10010101100011010
NAM  Q93PY3_PSEFL/1-187
ASQ  MLQLHKIELHQNAASFPNPLVPREVLADVENANQLLSHAQAKADELIRRAGEKCEA----MQKQTSLEFWQRADKQLKCWEHEREGILASLEHHATLVINQAIQRILDETVEPQRLQALIQQLLASQIPQVNATLLCCPSEFEHVKKYLA-SYGATLWKLQPDATALPQTLTLRTNEGDFLINWNSMLEMLL
DSQ  ATGCTTCAACTACACAAAATTGAGTTGCACCAGAACGCTGCCAGTTTTCCAAACCCCTTGGTTCCCCGAGAAGTACTCGCAGACGTCGAAAACGCCAATCAGCTCCTGTCGCATGCACAAGCGAAGGCTGACGAGCTGATAAGAAGAGCGGGTGAGAAATGTGAGGCG------------ATGCAGAAGCAAACCTCGTTAGAATTCTGGCAACGCGCCGACAAGCAACTCAAGTGCTGGGAACATGAGCGTGAGGGAATTCTGGCAAGCCTTGAACACCACGCGACCTTAGTCATCAACCAGGCCATCCAGCGCATCCTTGACGAGACTGTCGAGCCTCAGCGCCTGCAAGCTCTCATACAGCAGCTGCTGGCTAGTCAAATACCGCAGGTCAACGCGACGCTACTGTGCTGCCCAAGCGAATTCGAGCATGTAAAGAAGTACCTTGCT---TCGTACGGGGCGACACTCTGGAAGCTGCAACCAGACGCCACTGCCCTCCCTCAAACCCTGACACTGAGGACAAACGAGGGAGATTTTCTTATCAACTGGAACTCAATGCTCGAGATGCTTCTT
TRN  10010101100011000
NAM  Q52478_PSESM/1-187
ASQ  MLAKRSIALTA-ATLLREPILRREDIADSLLARDILADARQQATQILALEQEKAEH----LQQQALAQFWENANAFLGELQVQREALQEQAMTAVEELLSESLRHLLDDTTLAERARALARNLAASQLNEAVATLSVHPQIADPVAEWLADSRFSEHWQLKRDATIASDSLRLSDANGAFDIAWADLRKGLL
DSQ  ATGCTCGCCAAACGCAGTATTGCTCTGACGGCC---GCTACGCTGCTGCGCGAACCGATCTTGCGCCGCGAAGACATCGCCGACAGCCTGCTGGCGCGCGACATCCTGGCAGACGCGCGGCAGCAGGCCACGCAGATACTGGCCCTTGAGCAAGAGAAAGCCGAGCAC------------CTTCAGCAGCAGGCGCTGGCGCAGTTCTGGGAAAACGCCAACGCGTTTCTCGGCGAGCTTCAGGTGCAGCGCGAGGCGTTGCAGGAGCAGGCAATGACCGCCGTAGAAGAACTGTTGAGTGAATCCCTGCGGCACTTGTTAGACGACACCACGCTGGCCGAACGTGCGCGGGCGCTGGCCAGAAACCTGGCCGCCAGCCAGCTCAATGAAGCGGTCGCGACGCTCAGTGTTCACCCCCAAATAGCCGACCCCGTGGCTGAGTGGCTGGCAGACAGCCGTTTTTCCGAGCACTGGCAACTCAAGCGCGATGCAACGATCGCCTCGGACAGCTTGCGTCTGAGCGATGCCAATGGCGCGTTCGATATCGCTTGGGCAGACCTGCGCAAGGGGCTGCTG
TRN  10010101100011010
NAM  O87461_PSESG/1-187
ASQ  MLAKRSITLTA-TALLPEPVLRREDIANSLLARDVLADAQRQAEQMLVLEQQKADL----VHQQALASFWENANAFLAELQVQREVLQQQAMAAVEELLSESLRHLLDDTTLAERAKALVKNLAGSQLNEAVANLSVHPDMAEPVAEWLADSRFAQYWQLKRDASLNTERLRLNDANGAFDIDWATLRSGLA
DSQ  ATGCTCGCCAAACGCAGTATTACGCTGACTGCC---ACTGCGCTTCTGCCTGAACCTGTGCTGCGTCGTGAAGACATTGCCAACAGCCTGCTGGCTCGTGATGTTCTAGCCGACGCGCAGCGCCAGGCAGAGCAAATGCTGGTTCTCGAACAACAGAAGGCCGACCTT------------GTGCATCAGCAGGCGCTGGCCAGCTTCTGGGAAAACGCCAATGCGTTCCTCGCTGAACTGCAGGTGCAGCGTGAAGTGTTACAGCAGCAAGCAATGGCTGCCGTAGAGGAATTGCTCAGCGAGTCGCTTCGGCACCTGCTTGACGACACGACGCTGGCCGAACGCGCCAAGGCACTGGTGAAAAATCTCGCGGGCAGTCAGCTCAACGAAGCGGTGGCGAACCTCAGCGTTCATCCCGACATGGCCGAACCGGTCGCCGAGTGGCTGGCTGACAGCCGGTTTGCCCAATACTGGCAGCTTAAGCGCGACGCATCGCTGAACACCGAACGCCTGCGTCTGAACGATGCCAATGGCGCGTTCGACATCGATTGGGCGACGCTGCGCAGCGGGCTGGCA
TRN  11011101101011010
//