EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06141 - Phage_tail_U)
FAM  PF06141
PID  Phage_tail_U
DES  Phage minor tail protein U
IPR  IPR009312
ANO  7
ALN  133
AID  0.578585
APH  ((Q9EYD7_ECO57/1-132:0.37490,(Q8X860_ECO57/1-133:0.21095,(Q8ZQG6_SALTY/1-133:0.14208,Q8ZN03_SALTY/1-133:0.13182):0.07227):0.24098):0.08459,Q8ZQ90_SALTY/1-133:0.33202,(O64326_BPN15/1-132:0.18736,Q8X3I3_ECO57/1-131:0.16955):0.18278);
ATP  ((Q9EYD7_ECO57/1-132,(Q8X860_ECO57/1-133,(Q8ZQG6_SALTY/1-133,Q8ZN03_SALTY/1-133))),Q8ZQ90_SALTY/1-133,(O64326_BPN15/1-132,Q8X3I3_ECO57/1-131));
ATL  2.1293
DNO  7
DLN  399
DID  0.612644
DPH  (((Q9EYD7_ECO57/1-132:0.33096,(Q8ZQ90_SALTY/1-133:0.30798,(O64326_BPN15/1-132:0.22815,Q8X3I3_ECO57/1-131:0.16691):0.10260):0.04233):0.14636,Q8X860_ECO57/1-133:0.20806):0.11392,Q8ZQG6_SALTY/1-133:0.16093,Q8ZN03_SALTY/1-133:0.14361);
DTP  (((Q9EYD7_ECO57/1-132,(Q8ZQ90_SALTY/1-133,(O64326_BPN15/1-132,Q8X3I3_ECO57/1-131))),Q8X860_ECO57/1-133),Q8ZQG6_SALTY/1-133,Q8ZN03_SALTY/1-133);
DTL  1.95181
RID  0.578585
RPH  ((Q9EYD7_ECO57/1-132:0.37490,(Q8X860_ECO57/1-133:0.21095,(Q8ZQG6_SALTY/1-133:0.14208,Q8ZN03_SALTY/1-133:0.13182):0.07227):0.24098):0.08459,Q8ZQ90_SALTY/1-133:0.33202,(O64326_BPN15/1-132:0.18736,Q8X3I3_ECO57/1-131:0.16955):0.18278);
RTP  ((Q9EYD7_ECO57/1-132,(Q8X860_ECO57/1-133,(Q8ZQG6_SALTY/1-133,Q8ZN03_SALTY/1-133))),Q8ZQ90_SALTY/1-133,(O64326_BPN15/1-132,Q8X3I3_ECO57/1-131));
RTL  2.1293
LNK  O64326_BPN15/1-132:O64326:AF064539
LNK  Q8X3I3_ECO57/1-131:Q8X3I3:BA000007
LNK  Q8X860_ECO57/1-133:Q8X860:AE005174
LNK  Q8ZN03_SALTY/1-133:Q8ZN03:AE008818
LNK  Q8ZQ90_SALTY/1-133:Q8ZQ90:AE008743
LNK  Q8ZQG6_SALTY/1-133:Q8ZQG6:AE008737
LNK  Q9EYD7_ECO57/1-132:Q9EYD7:AP000400
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8ZN03_SALTY/1-133
ASQ  MSKHTLIRRAVLEKLESVTGAPVTLFDGLPAFVEQEDLPAIAVWLTDAQYTGLMTDEDDWQATLHTAVFLRAQAPDTELDIWMEEKIFPALEEVSGLERLIDTMTPLGYDYQRDSEMATWGMAEITYRITYTN
DSQ  ATGAGCAAACACACATTAATCCGCCGGGCCGTTCTGGAAAAGCTGGAATCCGTGACTGGCGCACCTGTCACTCTTTTTGATGGACTTCCTGCTTTCGTAGAACAGGAAGATTTACCCGCAATAGCTGTCTGGCTGACAGACGCACAGTATACAGGCCTTATGACCGATGAGGATGACTGGCAGGCTACTCTCCATACGGCAGTTTTTCTGAGGGCTCAGGCTCCTGATACAGAGCTTGATATCTGGATGGAAGAAAAAATCTTTCCTGCGCTGGAAGAGGTTAGTGGTCTGGAGCGCCTTATCGATACCATGACCCCGCTGGGTTATGACTACCAGCGTGACAGCGAAATGGCAACGTGGGGGATGGCAGAAATTACTTACCGGATCACCTATACCAAC
TRN  10010101100011010
NAM  Q8ZQG6_SALTY/1-133
ASQ  MNKHTQIRHAVLAKLESLSGSSAMLHDGLPVFIEPEELPALAVWLTDAQFAGQMLDERDWEAVLHVAVFLKAQAPDAELDMWMEEKIFPALEEVRGLENLINTMTPLGYDYQRDSEMATWGMAEITYRITYTN
DSQ  ATGAACAAACACACCCAGATTCGCCACGCCGTGCTGGCGAAACTTGAATCCCTGTCTGGATCGTCCGCCATGCTGCACGACGGTTTGCCGGTCTTTATTGAACCAGAAGAGCTTCCCGCACTGGCTGTCTGGTTGACCGATGCGCAGTTCGCCGGGCAGATGCTTGATGAACGCGACTGGGAGGCCGTTCTCCATGTGGCGGTATTTCTGAAAGCGCAGGCCCCGGATGCGGAACTTGATATGTGGATGGAAGAGAAAATATTCCCCGCACTGGAAGAGGTCAGAGGCCTGGAAAACCTTATCAATACGATGACGCCGCTGGGTTATGACTACCAGCGCGACAGTGAAATGGCAACGTGGGGCATGGCAGAAATCACGTACCGGATCACCTACACCAAC
TRN  10010101100011011
NAM  Q8X860_ECO57/1-133
ASQ  MNRHTQIRQVVLARLREQCGDSATFFDGLPAFVDAQELPAVAVWLSDAQYTGKMTDEDDWQAVLHIAVFIRAQAPDSELDMWMESTIFPALNDVSALSGLIDTLIPLGFNYQRDNEMATWAMAEITYQITYTN
DSQ  ATGAACCGACATACACAAATCCGCCAGGTCGTACTGGCACGCCTTCGGGAACAGTGTGGAGACAGCGCCACGTTTTTTGACGGGCTTCCGGCATTTGTTGATGCGCAGGAACTGCCTGCCGTGGCGGTGTGGCTGAGTGATGCTCAGTACACCGGAAAAATGACGGATGAAGATGACTGGCAGGCTGTTCTGCATATTGCTGTCTTCATCCGGGCACAGGCACCGGATTCAGAGCTGGATATGTGGATGGAGAGCACCATTTTCCCGGCCCTGAATGATGTATCGGCACTTTCCGGACTCATCGACACCCTGATCCCACTCGGTTTTAACTATCAACGTGATAATGAGATGGCCACCTGGGCGATGGCGGAAATCACGTACCAGATCACGTACACGAAT
TRN  11011101101011001
NAM  Q9EYD7_ECO57/1-132
ASQ  M-KHREIRAAVLSALKENISERVSWFDGRPVFIDEQELPAVAVYLTDASAADEFVDEGTWEATLHIEVFLRAKEPDSALDMWMEEKILPALEAVPGLSALLLKMNLQGYDYRRDDEFMMWGSADLLWKITYEM
DSQ  ATG---AAACACCGTGAAATACGGGCGGCAGTTCTGTCTGCCCTGAAAGAAAATATTTCTGAGAGGGTGAGCTGGTTTGACGGTCGCCCGGTTTTTATTGATGAACAGGAACTGCCTGCTGTTGCTGTTTACCTGACAGATGCGTCTGCTGCTGACGAGTTCGTTGATGAGGGAACCTGGGAGGCGACACTGCATATTGAGGTTTTTCTCAGGGCAAAAGAACCGGACTCGGCACTGGATATGTGGATGGAAGAAAAAATTCTTCCTGCGCTGGAGGCAGTTCCCGGGCTCAGTGCATTACTGCTGAAGATGAATCTTCAGGGGTATGACTACCGCCGGGATGATGAGTTTATGATGTGGGGATCGGCAGATCTCCTGTGGAAAATTACCTACGAGATG
TRN  10010101100011010
NAM  Q8X3I3_ECO57/1-131
ASQ  M-KHTDIRAAVLDALE-LHEHGATLFDGRPVVFDEEDFPAVAVYLTDAEYTGEELDADTWRATLHIEVFLPAQVPDSELDQWMESRIYPAVTAIPALADLITTMVTQGYEYRRDDDMALWSSADLTYSITYEM
DSQ  ATG---AAACATACTGATATCCGTGCGGCAGTGCTGGATGCACTGGAG---CTGCATGAACACGGGGCGACGCTGTTTGATGGTCGCCCCGTTGTTTTTGACGAAGAGGATTTTCCGGCCGTCGCGGTTTATCTGACGGATGCAGAGTATACCGGTGAAGAGCTGGATGCAGATACCTGGCGGGCCACACTGCATATTGAGGTGTTTTTACCGGCACAGGTACCGGATTCGGAGCTTGATCAGTGGATGGAAAGCCGGATTTATCCGGCGGTGACTGCGATCCCGGCACTGGCAGACCTGATTACGACGATGGTTACGCAGGGCTATGAGTATCGTCGTGATGACGATATGGCGTTATGGAGTTCTGCGGATCTGACTTATTCCATTACATACGAGATG
TRN  11011101101011010
NAM  O64326_BPN15/1-132
ASQ  M-KHRDIRKVIIDALESAIGTDAIYFDGRPAVLEEGDFPAVAVYLTDAEYTGEELDADTWQAILHIEVFLEAQVPDSELDDWMETRVYPVLAEVPGLESLITTMVQQGYDYQRDDDMALWSSADLKYSITYDM
DSQ  ATG---AAACACAGAGATATTCGCAAGGTGATTATTGACGCGCTGGAGAGCGCGATTGGTACTGACGCCATTTATTTTGACGGCAGACCTGCAGTGCTCGAAGAGGGTGATTTTCCCGCTGTTGCCGTTTACCTGACCGATGCGGAATACACAGGGGAAGAACTGGACGCCGACACCTGGCAGGCCATTCTGCATATCGAAGTCTTTCTTGAGGCTCAGGTACCTGATTCTGAGCTGGATGACTGGATGGAGACGCGAGTGTATCCGGTTCTCGCAGAGGTTCCAGGGCTTGAATCCCTTATCACCACAATGGTTCAGCAGGGCTATGACTACCAGCGCGATGACGATATGGCGCTGTGGAGTTCTGCCGACCTGAAATATTCCATTACTTACGACATG
TRN  10010101100011011
NAM  Q8ZQ90_SALTY/1-133
ASQ  MTRHSAVRQAIIAALKKTDDGSTTFFDGRPVVVEEDELPAVAVYLSDAQYTGPEVDGDIWSAVLHVEVFLKATAPDSALDEQMENRVYPALGSVAGLGDIIRTMSAQGYNYQRDDEMAMWGSADLSYDITYSM
DSQ  ATGACCCGACACAGTGCAGTACGGCAGGCCATTATTGCCGCATTAAAAAAGACCGATGATGGCTCCACCACGTTTTTTGACGGTCGTCCGGTCGTGGTGGAGGAGGATGAGTTACCTGCGGTGGCGGTGTACCTGAGTGATGCTCAGTATACCGGTCCTGAGGTGGACGGTGATATCTGGAGCGCGGTGCTACATGTGGAAGTATTTCTGAAAGCCACTGCACCGGACAGCGCCCTGGATGAACAGATGGAGAACAGGGTGTATCCGGCACTGGGGAGCGTGGCGGGACTGGGTGACATCATCCGGACAATGTCGGCGCAGGGGTATAACTATCAGCGAGACGATGAAATGGCGATGTGGGGGTCAGCCGATCTGAGTTACGACATCACCTATTCCATG
TRN  10010101100011000
//