EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06134 - RhaA)
FAM  PF06134
PID  RhaA
DES  L-rhamnose isomerase (RhaA)
IPR  IPR009308
ANO  5
ALN  417
AID  0.654375
APH  ((RHAA_BACSU/1-417:0.12389,RHAA_BACHD/1-417:0.16201):0.06628,Q8ESX0_OCEIH/1-417:0.08915,(RHAA_LISMO/5-420:0.28205,RHAA_ECO57/3-418:0.33106):0.21558);
ATP  ((RHAA_BACSU/1-417,RHAA_BACHD/1-417),Q8ESX0_OCEIH/1-417,(RHAA_LISMO/5-420,RHAA_ECO57/3-418));
ATL  1.27002
DNO  5
DLN  1251
DID  0.619689
DPH  ((RHAA_BACSU/1-417:0.19110,RHAA_BACHD/1-417:0.19325):0.08312,Q8ESX0_OCEIH/1-417:0.16103,(RHAA_LISMO/5-420:0.27095,RHAA_ECO57/3-418:0.39228):0.14479);
DTP  ((RHAA_BACSU/1-417,RHAA_BACHD/1-417),Q8ESX0_OCEIH/1-417,(RHAA_LISMO/5-420,RHAA_ECO57/3-418));
DTL  1.43652
RID  0.654375
RPH  ((RHAA_BACSU/1-417:0.12389,RHAA_BACHD/1-417:0.16201):0.06628,Q8ESX0_OCEIH/1-417:0.08915,(RHAA_LISMO/5-420:0.28205,RHAA_ECO57/3-418:0.33106):0.21558);
RTP  ((RHAA_BACSU/1-417,RHAA_BACHD/1-417),Q8ESX0_OCEIH/1-417,(RHAA_LISMO/5-420,RHAA_ECO57/3-418));
RTL  1.27002
LNK  Q8ESX0_OCEIH/1-417:Q8ESX0:BA000028
LNK  RHAA_BACHD/1-417:Q9KCL9:AP001512
LNK  RHAA_BACSU/1-417:O05264:Z93938
LNK  RHAA_ECO57/3-418:P58506:AP002567
LNK  RHAA_LISMO/5-420:Q8Y3I7:AL591984
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RHAA_BACHD/1-417
ASQ  MSMKSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELSKGELSGGIDVTGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
DSQ  ATGAGCATGAAAAGTCAATTTGAGCGAGCGAAAATAGAATATGGACAATGGGGCATTGACGTAGAGGAAGCACTTGAGCGGTTGAAGCAAGTTCCAATATCGATCCATTGCTGGCAAGGAGACGATGTAGGCGGCTTCGAATTGAGCAAAGGCGAGTTGTCTGGCGGGATTGATGTGACGGGAGATTATCCAGGGAAAGCGACCACCCCTGAAGAGTTACGGATGGACTTAGAAAAAGCGCTGTCGCTGATCCCGGGAAAGCATCGCGTTAATTTGCATGCGATTTATGCAGAAACGGACGGTAAAGTGGTGGAGCGGGATCAACTCGAACCGAGGCATTTTGAAAAGTGGGTCCGTTGGGCGAAAAGGCATGGGCTAGGGCTAGATTTTAACCCGACGTTGTTTTCTCATGAAAAAGCGAAAGACGGACTGACCCTTGCTCACCCAGACCAAGCGATCCGTCAGTTTTGGATCGACCATTGTATCGCTAGTCGAAAGATTGGTGAGTATTTTGGGAAAGAGCTCGAGACCCCGTGTTTAACGAACATTTGGATTCCTGATGGTTACAAAGATACACCGAGTGATCGCTTGACCCCTCGAAAACGATTAAAGGAATCGCTGGATCAAATTTTTGCTGCTGAGATCAATGAAGCGTACAATCTTGATGCGGTGGAAAGCAAGCTGTTTGGCATCGGCTCTGAATCATATGTCGTCGGCTCCCACGAGTTTTATTTAAGCTATGCCTTGAAAAATGATAAGCTCTGCTTACTCGATACAGGCCATTACCACCCGACTGAAACGGTCTCTAATAAAATTTCCGCGATGCTCCTTTTTCATGATAAGCTCGCTTTACACGTCTCCCGACCGGTTCGCTGGGATAGCGATCACGTCGTCACGTTTGATGATGAGCTGAGGGAAATTGCCTTGGAAATTGTGCGAAACGATGCTCTTGATCGCGTCCTGATCGGATTGGATTTCTTTGATGCGAGCATTAATCGAATCGCGGCGTGGACGATTGGAACGCGCAATGTGATTAAAGCATTGTTGTTCGCTATGCTCATCCCGCACAAACAGTTAAAAGAGTGGCAGGAGACAGGAGATTATACGAGACGGTTGGCAGTGCTAGAAGAATTTAAAACGTATCCGCTGGGCGCGATATGGAATGAATATTGCGAAAGGATGAATGTGCCCATTAAAGAGGAGTGGCTCAAGGAGATTGCGATTTATGAGAAAGAAGTGCTGCTCCAGCGC
TRN  10010101100011000
NAM  Q8ESX0_OCEIH/1-417
ASQ  MDVKQNYEQAKKQYEKWGVNVEDALEKLKQIPISIHCWQGDDVTGFEVNQQELSGGIDVTGNYPGKATTPEELRDDLDKALSLIPGMHRVNLHAIYAETNGEAVERDEIEPKHFENWVKWAKENGLGLDFNPTLFSHPKADDGLTLAHPNKEIRDFWIRHTIASRKIAAYMGKELGTSALTNIWTPDGYKDIPSDRLTPRKRLEDSLNQIFEEEIDKEYNVDAVESKLFGIGSEAYVVGSHEFYMGYALKNNKLCLLDTGHYHPTEMVSNKISSMLLYSDELALHVSRPVRWDSDHVVILDDELREIGLEIVRNDALDKVRIGLDFFDASINRIAAWTIGTRNMIKSLLYALLTPNEHLKQLQEEGNFTDRLAIMEELKTYPFGAIWDYYCESMNVPVGESWLTEVKEYEKEVLSKR
DSQ  ATGGACGTCAAACAAAATTATGAACAAGCGAAAAAACAATATGAAAAATGGGGAGTTAATGTTGAGGATGCGTTAGAGAAGCTAAAACAAATTCCGATTTCGATTCATTGTTGGCAAGGGGATGATGTGACAGGATTTGAAGTCAATCAACAGGAGTTATCGGGGGGGATCGATGTAACGGGAAATTACCCAGGTAAAGCAACTACACCAGAGGAATTACGAGATGACCTTGATAAAGCTTTATCACTGATTCCTGGTATGCACCGAGTCAATCTACATGCAATATATGCAGAAACAAATGGAGAAGCCGTGGAACGTGATGAGATTGAGCCTAAGCATTTTGAAAACTGGGTAAAATGGGCAAAAGAAAACGGTTTAGGACTTGACTTTAATCCAACATTATTTTCTCATCCAAAAGCAGATGACGGTTTAACGTTAGCACACCCAAATAAAGAGATTCGAGATTTTTGGATTCGTCATACGATTGCCAGCCGTAAAATAGCGGCTTACATGGGGAAAGAGTTAGGGACTTCTGCCTTAACAAACATCTGGACTCCAGATGGATATAAAGATATCCCAAGTGATCGTCTGACACCTAGAAAACGTCTAGAAGATTCCCTAAACCAAATATTTGAAGAGGAAATAGATAAGGAATATAACGTTGACGCAGTAGAGAGCAAACTATTTGGAATAGGATCGGAAGCATATGTAGTAGGTTCACATGAGTTTTATATGGGATATGCATTGAAAAATAATAAATTATGTCTACTAGATACAGGACATTATCATCCTACAGAAATGGTATCTAATAAAATTTCTTCGATGCTATTATATAGTGATGAATTAGCTTTACATGTATCTAGACCAGTTCGTTGGGATAGTGATCATGTTGTTATATTAGATGATGAATTACGTGAAATTGGCTTAGAGATTGTCCGAAATGATGCTTTAGATAAAGTTAGAATCGGCCTTGATTTCTTTGATGCAAGCATAAACCGAATTGCAGCATGGACAATCGGTACTCGGAATATGATTAAATCGTTATTATATGCGTTACTAACACCGAACGAGCATTTAAAACAATTACAAGAAGAAGGTAACTTCACAGATCGCTTAGCGATAATGGAAGAATTAAAAACTTATCCATTTGGGGCTATTTGGGATTACTACTGTGAATCCATGAATGTACCAGTTGGAGAGTCATGGTTAACAGAGGTAAAAGAATATGAAAAAGAAGTTTTATCTAAGCGA
TRN  10010101100011000
NAM  RHAA_BACSU/1-417
ASQ  MTIKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGGIDVTGNYPGKAQTPEELRRDLEKALSLIPGKHRVNLHAIYAETNREAVERDELKPQHFENWVKWAKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRHCIACRRIGEYFGKELGTPCLTNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESYVVGSHEFYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDHVVVLDDELREIALEIVRNHALEKVAIGLDFFDASINRVAAWTIGTRNMIKALLYALLLPNGYLKQLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKEAWLYDIKEYEQQVLLKR
DSQ  ATGACCATAAAAGCCAATTATGACAGTGCAAAACAGGCATATGAAAAATGGGGAATTGATGTTGAAGAGGCGCTTCGGCAATTAGAGCAAGTGCCCATTTCGATCCACTGCTGGCAGGGTGACGACATTGAAGGCTTTGAAGTAAATAAGGGCGAGCTTTCAGGCGGAATTGACGTGACCGGCAATTATCCCGGAAAAGCGCAAACTCCTGAAGAATTAAGAAGAGATTTGGAGAAGGCTCTTTCTCTCATTCCTGGAAAGCACCGCGTAAACCTGCATGCGATATACGCAGAAACAAACAGGGAAGCGGTAGAACGTGACGAATTGAAGCCGCAGCATTTTGAAAACTGGGTGAAATGGGCAAAAAACCTTGGTCTCGGTTTAGATTTTAATCCAACCTTGTTTTCGCATGAGAAAGCGGCTGACGGACTCACCCTTTCACACCCTGATCCGGACATCAGAGAATTTTGGATCAGGCATTGCATCGCTTGCCGCCGTATCGGGGAATACTTCGGGAAAGAATTAGGAACACCTTGCTTGACGAATATTTGGATTCCCGACGGCTATAAGGATATCCCGAGTGATAGGCTGACACCGCGTAAAAGACTAAAAGAATCACTGGATCGGATCTTCTCAGAGGAGATCAGTGAACAACATAATCTTGATTCAATCGAGAGCAAGCTGTTCGGGCTTGGCTCCGAATCATATGTTGTCGGATCTCATGAATTTTATTTAGCTTATGCTTTGACGAATCATAAGCTTTGTTTACTTGATACAGGCCATTTCCATCCGACTGAGACGGTATCAAACAAGATCTCGTCCATGCTGCTTTACACAGACAAGCTTGCCTTGCACGTATCGCGGCCTGTTCGTTGGGATAGCGACCATGTAGTGGTTTTGGATGATGAATTGAGAGAAATCGCTCTTGAAATTGTACGAAATCATGCTCTTGAGAAGGTAGCCATCGGTCTGGATTTTTTCGATGCCAGCATTAACCGTGTAGCCGCCTGGACCATCGGAACGAGAAATATGATCAAAGCTTTATTGTATGCCCTGCTTCTCCCGAACGGATATTTAAAACAATTGCAGGAAGAGGGCCGCTATACAGAAAGGCTGGCCCTGATGGAGGAATTCAAAACATATCCTTTCGGAGCCATCTGGGATTCCTACTGTGAGCAAATGGGCGTTCCGGTAAAAGAGGCATGGCTTTATGACATCAAAGAATATGAGCAACAGGTGCTTTTAAAAAGG
TRN  10010101100011000
NAM  RHAA_LISMO/5-420
ASQ  TEINKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGGIMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTPWVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGKRSRKISEYFGKELGQTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAYTVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDHVVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPTADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDWLKEVKAYEEDVLLKR
DSQ  ACAGAAATTAATAAACGATATCAAGTGGCGAAAGAACGTTATCAAGCAATTGGAGTTGATACGGAAAAAGCGCTTAAAACACTGAAAGACATTAAAATTTCGATGCACTGCTGGCAAGGCGATGATGTTAAAGGTTTCTTAAATCCAGACGGCGAACTTACAGGCGGAATCATGGCGACCGGGAATTATCCGGGTGCGGCTCATACTCCTAAGCAATTACGCCAAGATTTGGAAAAAGCTTATTCACTTATTCCTGGAAAACATAAACTTAACTTACACGCAATTTACGTAGATACAGAT---GAAAAAGTAGATTTAAATGAAATTGAACCTAAGCATTTCACTCCATGGGTAGAGTGGGCGAAAGAACAAGGTTTGGGTCTTGATTTCAACCCAACTTTCTTTTCACATCCAATGTTTAAAGACAATTACACTTTAGCTTCACCAGATAAAGAAGTTCGCGATTTTTGGATAGAGCACGGGAAACGCTCGCGAAAAATTTCTGAGTACTTTGGGAAAGAACTTGGTCAAACAAGTATTAATAATTTTTGGGTGCCGGATGGTATAAAAGATTGTCCGATTGATCGCTACACCCCGAGAAAACGTTTAATGGAAGCTTTAGATGAAGTTTTTGCAGAAAAATTAGATGAAAAATATACCCAAGAAGCTGTAGAAAGTAAGCTGTTTGGTCTAGGAGCAGAGGCTTATACTGTCGGTTCGCATGAATTTTATATGGGTTACGGAATTACGCGGGATAAATTGATTTGCTTGGATGCGGGACATTTCCATCCAACTGAAGTCATTTCTAATAAATTATCTTCTTTGGCACTTTTCAGTAAAGGCGTCATGTTACATGTGAGTCGTCCAGTCCGCTGGGATAGTGACCATGTGGTGATTATGGATGATGAATTAATTGAAATTGGTCGCGAATTGGTGCGCAATGATTTACTTGGGATTACAAATATCGGTCTTGATTTCTTCGACGCAACAATCAATCGGATTGCTGCATGGGTTGTTGGAACTAGAAATACGCAAAAATCATTACTTAAAGCTCTTTTAGAACCTACAGCTGATTTGAAAAAAATGGAACTGGAAAATGATTTTACATCTCGTATGGCAATTACAGAAGAATTGAAAGACTTCCCATTTGGCGATGTATGGAACTACTTCTGTGAAATTAATGGTGTCCCAGTTGGTTTGGACTGGTTGAAGGAAGTAAAAGCTTATGAAGAAGATGTATTACTAAAAAGA
TRN  10010101100011000
NAM  RHAA_ECO57/3-418
ASQ  TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESD-TPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLDPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWIIGTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKETLSRR
DSQ  ACTCAACTGGAACAGGCCTGGGAGCTGGCGAAACAGCGTTTCGCGGCAGTAGGGATTGATGTCGAGGAGGCGCTGCGCCAACTTGATCGTTTACCCGTTTCAATGCACTGCTGGCAGGGTGATGATGTTTCCGGTTTTGAAAACCCGGAAGGTTCGCTGACCGGAGGGATTCAGGCTACTGGCAATTATCCGGGCAAAGCGCGTAATGCCAGTGAGCTACGTGCCGATCTGGAACAGGCTATGCGGCTGATTCCGGGGCCAAAACGGCTTAATTTACATGCCATCTATCTGGAATCAGAC---ACGCCAGTCTCGCGCGACCAGATCAAACCTGAGCACTTCAAAAACTGGGTTGAATGGGCGAAAGCCAATCAGCTCGGTCTGGATTTTAACCCCTCCTGTTTCTCGCATCCGCTAAGCGCCGATGGCTTTACGCTTTCCCATGCCGACGACAGCATTCGCCAGTTCTGGATTGATCACTGCAAGGCCAGCCGCCGCGTTTCGGCCTATTTTGGTGAGCAACTCGGCACACCGTCGGTGATGAACATCTGGATCCCGGATGGCATGAAAGATATCACCGTTGACCGTCTCGCTCCGCGCCAGCGTCTGCTGGCAGCTCTGGATGAGGTGATCAGCGAGAAGCTGGATCCGGCGCACCATATCGACGCCGTTGAGAGCAAATTGTTTGGCATTGGCGCAGAGAGCTACACGGTTGGCTCCAATGAGTTTTACATGGGGTATGCCACCAGCCGCCAGACTGCGCTGTGCCTGGACGCCGGGCATTTCCACCCGACTGAAGTGATTTCCGACAAGATTTCCGCCGCCATGCTGTATGTGCCGCAGTTGCTGCTGCACGTCAGCCGTCCGGTTCGCTGGGACAGCGATCACGTAGTGCTGCTGGATGATGAAACCCAGGCGATTGCCAGTGAGATTGTTCGTCACGATCTGTTTGACCGGGTGCATATCGGCCTCGACTTCTTTGATGCCTCTATCAACCGTATTGCTGCGTGGATCATTGGTACACGCAATATGAAAAAAGCCCTGCTGCGTGCGTTGCTGGAACCTACCGCTGAGCTGCGCAAGCTGGAAGCGGCGGGCGATTACACTGCGCGTCTGGCACTGCTGGAAGAGCAGAAATCGTTGCCGTGGCAGGCGGTCTGGGAAATGTATTGCCAACGTCACGATACGCCAGCAGGTAGCGAATGGCTGGAGAGCGTGCGGGCATATGAGAAAGAAACTTTGAGTCGCCGC
TRN  11011101101011000
//