EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06100 - Strep_67kDa_ant)
FAM  PF06100
PID  Strep_67kDa_ant
DES  Streptococcal 67 kDa myosin-cross-reactive antigen like family
IPR  IPR010354
ANO  8
ALN  509
AID  0.554388
APH  ((((Q8K8E2_STRP3/21-521:0.25158,Q9CGY7_LACLA/21-517:0.20514):0.13292,(Q8Y9P3_LISMO/47-535:0.94424,(Q8DVH4_STRMU/21-521:0.29430,Q8XNF5_CLOPE/30-531:0.35159):0.07871):0.07284):0.05415,Q8DT14_STRMU/21-519:0.34311):0.11847,Q8CPN7_STAEP/21-520:0.13023,Q8NYT3_STAAW/21-520:0.11892);
ATP  ((((Q8K8E2_STRP3/21-521,Q9CGY7_LACLA/21-517),(Q8Y9P3_LISMO/47-535,(Q8DVH4_STRMU/21-521,Q8XNF5_CLOPE/30-531))),Q8DT14_STRMU/21-519),Q8CPN7_STAEP/21-520,Q8NYT3_STAAW/21-520);
ATL  3.09619
DNO  8
DLN  1527
DID  0.59399
DPH  ((Q8K8E2_STRP3/21-521:0.24967,Q9CGY7_LACLA/21-517:0.20072):0.06997,Q8DT14_STRMU/21-519:0.31039,(((Q8Y9P3_LISMO/47-535:0.55274,Q8XNF5_CLOPE/30-531:0.25360):0.08236,Q8DVH4_STRMU/21-521:0.27372):0.05789,(Q8CPN7_STAEP/21-520:0.18212,Q8NYT3_STAAW/21-520:0.14842):0.10615):0.05143);
DTP  ((Q8K8E2_STRP3/21-521,Q9CGY7_LACLA/21-517),Q8DT14_STRMU/21-519,(((Q8Y9P3_LISMO/47-535,Q8XNF5_CLOPE/30-531),Q8DVH4_STRMU/21-521),(Q8CPN7_STAEP/21-520,Q8NYT3_STAAW/21-520)));
DTL  2.53918
RID  0.554388
RPH  ((((Q8K8E2_STRP3/21-521:0.25158,Q9CGY7_LACLA/21-517:0.20514):0.13292,(Q8Y9P3_LISMO/47-535:0.94424,(Q8DVH4_STRMU/21-521:0.29430,Q8XNF5_CLOPE/30-531:0.35159):0.07871):0.07284):0.05415,Q8DT14_STRMU/21-519:0.34311):0.11847,Q8CPN7_STAEP/21-520:0.13023,Q8NYT3_STAAW/21-520:0.11892);
RTP  ((((Q8K8E2_STRP3/21-521,Q9CGY7_LACLA/21-517),(Q8Y9P3_LISMO/47-535,(Q8DVH4_STRMU/21-521,Q8XNF5_CLOPE/30-531))),Q8DT14_STRMU/21-519),Q8CPN7_STAEP/21-520,Q8NYT3_STAAW/21-520);
RTL  3.09619
LNK  Q8CPN7_STAEP/21-520:Q8CPN7:AE016746
LNK  Q8DT14_STRMU/21-519:Q8DT14:AE014990
LNK  Q8DVH4_STRMU/21-521:Q8DVH4:AE014897
LNK  Q8K8E2_STRP3/21-521:Q8K8E2:AE014143
LNK  Q8NYT3_STAAW/21-520:Q8NYT3:BA000033
LNK  Q8XNF5_CLOPE/30-531:Q8XNF5:BA000016
LNK  Q8Y9P3_LISMO/47-535:Q8Y9P3:AL591975
LNK  Q9CGY7_LACLA/21-517:Q9CGY7:AE006330
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CGY7_LACLA/21-517
ASQ  DQKSAYIIGAGLAGLATAVFLIRDGQMSGDRIHILEELPLSGGSLDGSFIPHDGFVVRGGREM-ENHFECLWDLFRTIPSLEVDDASILDEFYRIDRDDPNSSNCRIIHNRGERVDDDGKFTLSPKAQEEIIKLFMTKEELLVGKTIEDCFTDEFFKSNFWLYWCSMFAFEKWHSAIEMRRYIMRFIHHIEGLPDFSALKFTKYNQYESLVKPLISYLKDHGVDFKYGAQVENVEVDFSNGKKVAKAIVF-.--ADKEIKELTENDLVFVTNGSITESSTQGSPTQAAPKTSEL--GGSWKLWQNLAKQSEEFGHPDVFCKEIPKEAWVVSATVTWKNLKIQPYFEKLTHRQLRSGKVITGGIITVKDSNWLLSFTTHRQPHFKEQNDQETVTWVYGLLSNTPGNYIKKPIEDCTGEEITQELLYHLGMPEEEIEAFV.KENTNTIPVYMPFITSYFMLREPGDRPLVVPEQSVNLAFLGNFAET----ERDTVFTTEYSVRTAMEAVY
DSQ  GATCAAAAATCAGCTTATATTATTGGGGCAGGCCTTGCAGGACTTGCAACAGCAGTATTTTTAATTCGTGACGGTCAAATGTCAGGGGACCGTATTCATATTTTAGAAGAGTTACCGTTGTCAGGAGGTTCTCTTGACGGTTCCTTTATTCCACATGATGGTTTCGTTGTTCGTGGTGGACGTGAAATG---GAAAACCATTTTGAATGTCTTTGGGATTTATTCCGAACAATTCCGTCATTAGAAGTGGACGATGCGTCTATTTTAGATGAGTTTTATCGAATTGATCGGGATGACCCAAATTCATCTAACTGTCGTATTATCCATAATCGTGGTGAACGGGTTGATGATGATGGAAAATTTACCCTAAGTCCAAAAGCTCAAGAAGAAATAATCAAATTATTCATGACTAAAGAAGAACTACTTGTAGGTAAAACAATAGAAGATTGCTTTACTGATGAGTTCTTCAAATCAAATTTTTGGCTTTATTGGTGTTCAATGTTTGCTTTTGAAAAATGGCATTCAGCTATTGAAATGCGTCGTTACATTATGCGTTTCATCCACCATATTGAGGGGTTACCTGATTTTTCTGCCCTAAAATTTACAAAATATAATCAATATGAATCGCTAGTAAAACCATTAATTTCATACTTAAAAGATCATGGAGTTGATTTTAAATATGGAGCACAGGTTGAAAATGTTGAAGTTGACTTTTCAAATGGCAAAAAGGTAGCAAAAGCTATTGTATTT---...------GCTGACAAAGAAATAAAAGAACTGACAGAAAATGACTTAGTTTTTGTCACAAATGGTTCAATTACAGAAAGTTCAACTCAAGGTTCACCAACACAAGCCGCTCCGAAAACTAGTGAACTT------GGTGGCTCTTGGAAACTTTGGCAAAATTTAGCTAAACAATCAGAAGAATTTGGACATCCAGATGTTTTTTGTAAGGAAATTCCAAAAGAAGCTTGGGTTGTATCAGCAACTGTCACTTGGAAAAATTTAAAGATTCAACCTTATTTTGAAAAATTAACACATCGTCAATTGCGTTCAGGAAAAGTTATCACAGGAGGAATTATTACTGTTAAAGATTCAAATTGGCTCCTTTCATTTACAACTCACCGCCAACCTCATTTTAAAGAACAAAATGACCAAGAAACAGTAACTTGGGTTTATGGTCTTCTTTCAAATACACCTGGGAACTATATCAAAAAACCAATTGAAGATTGTACAGGTGAAGAAATTACTCAAGAATTACTTTATCATTTAGGAATGCCAGAAGAAGAAATTGAAGCATTTGTT...AAAGAAAATACTAATACAATTCCAGTATATATGCCTTTCATTACTTCTTATTTCATGCTTCGTGAACCAGGGGATCGCCCTCTTGTAGTACCTGAACAATCAGTCAATTTAGCGTTTTTAGGAAATTTTGCGGAAACT------------GAGCGTGATACAGTCTTTACAACAGAGTATTCAGTCAGAACTGCGATGGAAGCTGTTTAT
TRN  10010101100011000
NAM  Q8K8E2_STRP3/21-521
ASQ  DQKSAYIVGTGLAGLAAAVFLIRDGHMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREM-ENHFECMWDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQS-KELIHLIMKTEESLGDQTIEEFFSEDFFKSNFWIYWATMFAFEKWHSAVEMRRYAMRFIHHIDGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKAAKTIHMT.VSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKAL--GGSWNLWENLAAQSDDFGHPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSNWMMSFAIHRQPHFKEQKDNETTVWIYGLYSNSEGNYVHKKIEECTGQEITEEWLYHLGVPVDKIKDLAsQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAES---PSRDTVFTTEYSIRTAMEAVY
DSQ  GATCAGAAATCAGCTTATATTGTTGGTACTGGTTTAGCTGGTTTAGCAGCAGCTGTTTTCCTTATTCGCGATGGGCATATGGCTGGGGAACGCATTCATCTGTTTGAGGAATTGCCTTTAGCAGGTGGTTCTTTAGATGGTATTGAAAAGCCTCATCTTGGTTTTGTGACCCGTGGTGGTCGTGAGATG---GAAAATCATTTTGAGTGTATGTGGGACATGTATCGGTCTATTCCCTCACTGGAAATTCCCGGTGCGTCTTATTTAGATGAATTTTATTGGTTGGATAAGGATGATCCTAACTCATCCAACTGTCGTTTGATTCACAAGAGAGGAAATCGTGTGGATGATGACGGCCAGTATACGCTCGGTAAACAGTCA---AAAGAATTAATCCATTTAATCATGAAGACAGAAGAATCTCTAGGAGACCAAACCATTGAAGAGTTCTTCTCAGAAGATTTCTTTAAGAGTAATTTTTGGATCTATTGGGCAACCATGTTTGCTTTTGAAAAATGGCACTCTGCTGTAGAAATGCGGCGCTATGCGATGAGGTTTATCCACCATATTGATGGTTTGCCAGATTTTACCTCCCTCAAGTTCAACAAATATAACCAATATGATTCTATGGTCAAACCGATTATTGCTTACCTAGAATCACACGACGTTGACATCCAATTTGACACAAAAGTCACTGATATTCAGGTGGAACAAACAGCTGGTAAAAAGGCAGCAAAAACCATCCATATGACG...GTGTCTGGGGAGGCTAAGGCGATTGAGCTAACACCTGATGATTTGGTTTTTGTGACCAATGGTTCTATTACTGAAAGTAGCACATACGGTAGTCATCACGAAGTGGCTAAGCCAACCAAAGCGTTA------GGTGGTTCTTGGAATTTATGGGAAAATCTAGCTGCTCAATCAGATGATTTTGGTCATCCTAAAGTGTTTTACCAGGACTTGCCTGCTGAAAGCTGGTTTGTGTCTGCCACAGCAACCATAAAACACCCAGCTATCGAGCCTTATATTGAACGTTTGACCCACCGTGATTTGCACGATGGCAAAGTGAACACTGGCGGCATCATCACTATTACAGATTCTAACTGGATGATGAGCTTTGCCATTCACCGTCAACCTCATTTTAAAGAACAAAAAGATAATGAGACCACTGTCTGGATTTACGGTCTTTATTCCAATAGTGAGGGCAATTACGTCCACAAGAAAATTGAGGAGTGTACAGGTCAAGAAATCACAGAAGAATGGTTGTACCACCTTGGGGTACCTGTTGATAAAATCAAGGACTTAGCGagtCAGGACTATATCAATACAGTTCCTGTTTACATGCCTTATATTACGAGTTACTTTATGCCACGTGTCAAAGGAGACCGTCCGAAAGTTATCCCAGATGGTTCAGTCAACTTGGCCTTTATTGGTAACTTTGCGGAATCT---------CCATCTCGAGATACGGTCTTTACGACTGAGTATTCTATTCGTACTGCCATGGAAGCAGTGTAT
TRN  10010101100011000
NAM  Q8NYT3_STAAW/21-520
ASQ  ENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPKAGGSLDGENMPLKGYVVRGGREM-ENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPNYSRCRVIEKQGQRLVTDGDFTLTKKAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFWIYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTKYNQYESLVLPMVEYLKSHGVQFEYGVKVEDIKVDVTTSQKIAREILIH.RHGKAESIKLTVDDLVFVTNGSITESSTYGDNDTPAPPTDEL--GGSWTLWKNLARQSPEFGNPDKFCQNIPQKSWFVSATSTTNNKDIIDTIESICKRDPLAGKTVTGGIITINDSAWQISFTINRQQQFKDQPKNEISTWIYALYSDVNGDYIKKPITECSGNEICQEWLYHLGVPTDKIEDLA.KHASNTIPVYMPYITSYFMTRAIGDRPLVVPHQSQNLAFIGNFAET----ERDTVFTTEYSVRTAMEAVY
DSQ  GAAAACAAATCCGCTTACTTAATCGGATCTGGTCTAGCTTCACTTGCTGCAGCTTGTTTTTTAATAAGGGATGGTCAAATGGAAGGTTCGAAGATTCATATTTTAGAAGAGTTACCTAAAGCAGGTGGTAGTCTTGATGGTGAAAATATGCCTTTAAAAGGCTATGTTGTCCGAGGTGGTCGTGAAATG---GAGAACCACTTTGAATGTTTGTGGGACTTATTCAGATCTATCCCTTCATTAGAAATCGATAACGCGTCTGTATTAGATGAGTTCTATTGGCTAAACAAAGAAGACCCTAACTATTCTCGCTGTCGAGTTATTGAAAAACAGGGTCAACGTTTAGTTACCGATGGAGACTTCACTTTGACCAAAAAAGCGATTAAAGAAATTTTAGATTTATGCTTAACGAATGAAGAAGATTTAGATGATGTCAAAATAACAGATGTATTTTCCGATGACTTCTTTAATTCAAACTTTTGGATTTACTGGAAAACGATGTTTGCATTTGAACCGTGGCATTCTGCTATGGAAATGCGTCGCTATCTAATGCGATTCGTTCATCATATTGGTGGTCTCGCAGACTTTTCAGCTTTAAAATTCACTAAATATAATCAATATGAATCTTTAGTATTACCTATGGTTGAATATTTAAAATCGCATGGGGTTCAATTTGAATACGGTGTAAAAGTAGAAGATATTAAAGTAGATGTTACGACAAGTCAAAAAATTGCCCGAGAAATATTAATTCAC...CGACATGGCAAAGCAGAGTCAATTAAACTGACTGTAGATGATCTTGTCTTTGTGACAAACGGTAGTATTACGGAAAGCTCTACGTATGGTGATAATGATACACCAGCACCACCAACTGACGAATTA------GGTGGTAGTTGGACACTATGGAAAAATTTAGCGCGACAAAGTCCTGAATTTGGTAATCCTGATAAGTTTTGCCAAAATATTCCTCAAAAGAGTTGGTTTGTTTCTGCAACATCGACAACAAACAATAAAGATATTATCGATACAATAGAAAGCATTTGTAAACGTGACCCTCTTGCAGGCAAAACGGTTACTGGCGGAATTATTACAATCAATGATTCTGCATGGCAAATCAGTTTTACAATCAATCGTCAGCAACAGTTTAAAGACCAACCTAAAAATGAAATATCTACATGGATTTATGCCTTATATTCAGATGTAAACGGCGATTATATTAAAAAGCCAATCACAGAATGTAGTGGTAATGAAATATGTCAAGAATGGCTGTATCACTTAGGTGTACCAACTGACAAAATTGAAGACTTAGCA...AAACATGCATCTAATACGATTCCTGTTTATATGCCATATATTACCTCTTATTTCATGACGCGTGCTATCGGCGACAGACCTTTAGTCGTCCCGCATCAATCACAAAATTTAGCATTTATTGGTAACTTTGCAGAAACA------------GAGCGAGATACTGTATTTACAACAGAATATTCGGTTCGTACTGCCATGGAAGCTGTTTAT
TRN  10010101100011000
NAM  Q8CPN7_STAEP/21-520
ASQ  DNKSAYLIGAGLASLAAACFLIRDGQMKGENIHILEELDISGGSLDGINMEHHGYVVRGGREM-ENHFECLWDLFRSIPSLEQTNASVLDEFYWLNKEDPNYSKCRAIESGGKRIDTDGDFTLTKKAIKEILNLCLMKEEDLDDVKITDVFSRDFLNSNFWLYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTKYNQYESLVLPMIEYLKSHSVNFEFGVQVNNILVDATPSTKIAREIILT.RDDKEESIPLTVNDLVFVTNGSITESSTYGDNDHPAPITHSL--GGSWTLWKNLANQSPEFGRPEKFCDHIPAKSWFVSATATTDNKKIISYIEQLCKRDVLSGRTVTGGIISVANSSWQLSFTVNRQQQFKKQPKNQVSVWIYALYSDEKGDFIKKPITECTGSEICQEWLYHMGVPQEEIVELA.QSECNTIPVYMPYVTAYFMPRAYKDRPLVVPNGSKNLAFIGNFAET----ARDTVFTTEYSVRTAMEAVY
DSQ  GATAATAAATCAGCCTATTTGATAGGGGCTGGATTAGCTTCTTTAGCTGCAGCATGTTTTTTAATTAGAGATGGACAAATGAAAGGCGAGAATATCCATATTTTAGAAGAGTTAGATATCTCAGGAGGAAGTTTAGATGGCATCAATATGGAGCATCATGGCTATGTAGTACGTGGTGGCAGAGAAATG---GAAAATCATTTTGAATGCTTATGGGATTTATTCAGAAGTATACCATCACTTGAGCAAACTAATGCTTCTGTGTTAGACGAGTTTTATTGGTTAAATAAAGAAGACCCTAATTATTCTAAATGTAGAGCGATTGAAAGTGGAGGTAAGCGTATTGATACTGATGGTGATTTTACATTAACAAAAAAAGCAATTAAAGAAATTTTAAATTTATGTTTGATGAAAGAAGAAGATTTAGACGATGTTAAAATCACTGATGTCTTTTCAAGAGACTTTTTAAATTCTAATTTTTGGCTTTATTGGAAAACAATGTTTGCATTCGAGCCATGGCATTCAGCGATGGAGATGCGTAGATATCTTATGCGTTTTGTGCATCATATTGGTGGTTTAGCAGATTTTAGTGCATTAAAATTTACTAAGTATAATCAATATGAATCTTTAGTATTACCGATGATAGAATATCTAAAATCACATAGCGTGAACTTTGAATTTGGAGTACAAGTGAATAATATTTTAGTTGATGCAACACCATCTACTAAAATTGCTAGAGAAATCATTTTAACT...AGAGATGATAAAGAAGAATCTATCCCGTTGACAGTTAATGACTTGGTATTTGTTACTAATGGAAGTATTACCGAAAGTTCAACCTATGGTGATAATGACCACCCTGCTCCTATAACACATTCTTTA------GGTGGTAGTTGGACATTATGGAAAAACTTAGCTAATCAAAGTCCTGAATTCGGAAGACCTGAGAAATTCTGTGATCACATTCCAGCTAAAAGTTGGTTCGTATCAGCAACGGCAACAACAGATAATAAAAAAATAATCTCATATATCGAACAATTATGTAAAAGAGATGTTTTATCAGGTCGGACAGTCACAGGCGGTATCATTTCTGTCGCTAATTCGAGTTGGCAACTTAGTTTTACAGTGAACCGTCAGCAACAATTTAAGAAACAACCTAAAAATCAAGTTAGTGTATGGATTTACGCATTATACTCTGACGAAAAAGGAGACTTCATTAAAAAACCAATCACGGAATGTACTGGTAGTGAAATCTGTCAAGAATGGTTATATCATATGGGTGTTCCACAAGAGGAAATTGTTGAATTAGCT...CAATCAGAATGTAACACGATTCCTGTTTATATGCCATATGTAACTGCATATTTCATGCCTAGAGCATACAAAGATCGACCGTTAGTAGTACCGAATGGCTCTAAAAATTTAGCATTTATTGGAAACTTTGCAGAAACA------------GCACGGGATACTGTATTCACTACAGAATATTCAGTTAGAACAGCTATGGAAGCTGTTTAT
TRN  10010101110011000
NAM  Q8DT14_STRMU/21-519
ASQ  DGKSAYIVGSGLAALSTAVFLIRDGQMAGERIHILEELSLPGGSMDGIRNERLGYIIRGGREM-EPHFEVLWDLFRSIPSLENPKHSILDEFYWLNKKDPSFAKTRAIYERGKAIPDDGQLTLSQKAVKEIFDLVLTPESHLQDVQIDQVFSEDFFNSNFWLYWSTMFAFEPWASAMEMRRYLMRFIQHVGTLKNLSSLKFTQYNQYESLILPLVAFLKDHNVNFSYQTVVTNILVNRSGSDKLATKIEMT.VNGQEKSIALSRDDLVFVTNGSITESSTYGNNNHPAPLTHDL--GASWQLWKNLAAQDSDFGCPEKFCENIPDANWTMSATITFTDQRIAKYIEQINQKDPYSGSIVTSGPTSIKDSSWLLGYSISRQPHFKEQKKNELVIWLYALYTDRKGDYVAKRPDECTGIEMCEEWLYHIGVPENTIHELA.-CSASTIPCHMPYITTYFMPRTTNDRPLVVPKHSKNLAFIGNYAET----PRDTVFTTEYSVRTAMEAVY
DSQ  GATGGGAAATCAGCTTATATTGTTGGAAGCGGCTTAGCGGCTCTTTCTACAGCAGTTTTTCTTATTCGTGACGGACAAATGGCTGGAGAACGCATTCATATTCTTGAAGAATTATCTCTTCCTGGTGGCAGTATGGATGGTATTCGTAATGAACGTTTAGGTTACATCATTCGCGGTGGTCGGGAAATG---GAGCCTCACTTTGAAGTCTTATGGGATTTATTTCGCTCTATCCCTTCTCTGGAAAATCCCAAACACTCTATTTTAGATGAATTCTACTGGCTTAATAAAAAGGATCCAAGTTTTGCTAAAACACGTGCCATCTATGAGCGTGGAAAGGCAATACCAGATGACGGTCAGTTGACCTTATCTCAAAAAGCAGTTAAGGAAATTTTTGATCTTGTTCTAACACCGGAAAGTCATCTGCAGGATGTTCAGATTGATCAAGTCTTTAGTGAAGATTTCTTCAACTCTAACTTCTGGCTTTATTGGAGTACCATGTTTGCTTTTGAACCATGGGCCAGTGCTATGGAAATGCGCCGTTACCTCATGCGATTCATTCAGCATGTTGGGACTTTGAAAAATCTCTCATCCTTAAAATTCACACAATACAATCAATATGAATCATTGATCTTACCACTAGTAGCTTTTCTCAAAGACCATAATGTCAATTTTAGCTATCAGACTGTTGTCACTAATATTTTAGTCAATCGTTCTGGCAGTGATAAGCTTGCTACTAAAATTGAAATGACT...GTTAATGGTCAAGAAAAAAGTATTGCTTTAAGTAGAGATGATCTTGTTTTTGTCACCAATGGCTCCATTACAGAAAGTAGTACTTACGGTAACAATAATCATCCAGCTCCATTAACGCACGATCTT------GGTGCCAGTTGGCAGCTGTGGAAGAATTTAGCTGCACAAGATAGTGATTTTGGATGTCCCGAAAAATTCTGTGAAAATATCCCTGATGCTAATTGGACCATGTCTGCTACAATAACTTTTACAGATCAACGCATTGCTAAATACATTGAACAGATTAACCAAAAGGATCCTTATAGTGGCTCTATTGTAACCAGCGGACCTACCAGCATTAAAGATTCTAGTTGGTTGCTTGGCTATTCTATCAGTCGACAACCACATTTTAAAGAACAAAAGAAAAATGAGCTTGTTATCTGGCTCTATGCTCTCTATACTGATCGCAAAGGAGATTATGTCGCTAAACGGCCTGATGAATGTACAGGGATTGAAATGTGTGAAGAATGGCTTTATCATATAGGAGTTCCTGAAAATACTATTCATGAACTAGCC...---TGTTCGGCCTCGACGATCCCTTGCCATATGCCTTATATAACAACGTATTTCATGCCGCGAACAACTAACGATCGCCCACTTGTTGTGCCAAAACATAGTAAGAATTTAGCTTTTATAGGAAACTATGCTGAAACA------------CCGCGAGATACGGTTTTTACAACAGAATATTCTGTCAGAACTGCTATGGAAGCTGTTTAC
TRN  10010101100011000
NAM  Q8XNF5_CLOPE/30-531
ASQ  ENKSAYLIGTGIGALAAGCFLIRDAHMDGSKITFFEQLDLPGGSLDGEVLQNLGYVARGGREM-GHHFEVLWGLFSSLPSTEDPNMTVLDHFFYTNYDDPNYSNCRITHKNGERYD-NAKFNLGQDLAKELAEFVLIPDEELQDKSIDEIFSEELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVGGLPTLSALQFSRHDQYTSFVKPMVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIVAKdKNGKDISVNLTENDLVFITNGSMTEGSGYGDDNTPAPFNKEP--QGCWELWRNIAKQSDEFGHPDKFCTDTEKSNW-ESCTVTCHDERVPKYIEKITKRSPYGGKTVTGGIVTAVDSSWLMSWTINRQEQYYGQPEKDVVVWVYGLFSDVEGDYIKKPMRDCTGKEITKEWLFHIGVPVDEIEELA.-ESCTAIPVMMPFITSQFMPREFGDRPYVVPKNAVNFAFLGQFAETLDDPGRDTVFTIEYSGRTAMEAVY
DSQ  GAAAATAAAAGTGCATATTTAATTGGTACTGGAATAGGTGCATTAGCAGCAGGATGTTTTTTAATTAGAGATGCACATATGGATGGTAGCAAAATAACATTTTTTGAACAATTAGATCTTCCAGGAGGCTCTTTAGATGGAGAAGTACTTCAAAATCTAGGTTATGTAGCTCGTGGTGGACGTGAAATG---GGACATCACTTTGAAGTTTTATGGGGTTTATTTAGTTCACTTCCATCTACTGAAGATCCAAATATGACAGTATTAGATCATTTCTTCTACACAAATTATGATGATCCAAACTATAGTAATTGTCGTATAACCCATAAAAATGGAGAAAGATATGAC---AATGCTAAATTTAATTTAGGACAAGATTTAGCTAAGGAATTAGCAGAGTTTGTTCTTATACCAGATGAAGAACTTCAAGATAAATCAATTGATGAAATATTCTCTGAAGAACTTTTAAATACAGACTTTTGGACATTATGGAGAACTATGTTTGCCTTTGAAAACTGGCATAGTGCTTTAGAAATGAAATTATATATGAATAGATTTATACACCATGTTGGTGGATTACCAACACTTTCAGCACTGCAATTCTCAAGACATGATCAATATACATCTTTTGTAAAACCAATGGTTAAATTCTTAAAAGAAAATGGGGCTAGGTTTGAATATGGAGTACATGTTGAAAATGTAGAATTTGACATAAGCGATGATAAAAAAGTGGCTAAAAAAATAGTTGCTAAGgatAAAAACGGAAAAGATATTTCTGTAAACTTAACTGAAAATGATTTAGTATTCATAACTAATGGTTCTATGACAGAAGGTTCAGGATATGGTGATGATAATACTCCTGCTCCATTTAATAAAGAACCA------CAAGGATGCTGGGAATTATGGAGAAATATTGCTAAACAATCAGATGAATTTGGACATCCAGATAAATTCTGTACAGACACTGAAAAATCAAACTGG---GAATCTTGTACAGTAACTTGTCATGATGAACGTGTACCAAAATATATTGAAAAGATAACTAAACGTTCACCATATGGAGGAAAGACTGTAACAGGAGGAATAGTTACAGCTGTGGACTCTTCATGGCTAATGAGTTGGACTATAAACCGTCAAGAACAATATTATGGCCAACCAGAAAAAGATGTAGTAGTTTGGGTATATGGACTATTCTCAGATGTTGAGGGTGATTATATTAAGAAACCTATGAGAGATTGTACTGGTAAGGAAATTACAAAGGAATGGTTATTCCATATAGGCGTTCCAGTTGATGAAATTGAAGAACTTGCT...---GAGTCTTGTACAGCAATTCCTGTAATGATGCCATTTATAACTTCACAATTTATGCCTCGTGAATTTGGAGACAGACCTTATGTTGTTCCTAAGAATGCAGTTAACTTTGCTTTCCTTGGACAATTTGCAGAAACTTTAGACGATCCAGGAAGAGATACAGTATTTACTATTGAATACTCAGGACGTACAGCTATGGAAGCAGTATAT
TRN  10010101100011000
NAM  Q8DVH4_STRMU/21-521
ASQ  EHKSAYIIGSGLAALSAACFLVRDGQMPGKQVHILEKDPIPGGACDGYQYSDIGYVMRGGREM-DNHFECMWDLFRSIPSIETEGVSVLDEYYWLNKADPNYSLCRATKKQGQDAHTDKKFTLSDKGAKEIMHLFFTPDEDLYNKRINEVFDGEVFDSNFWLYWRTMFAFENWHSALEMKLYLKRFIHHISGLPDFTALRFTKYNQYESMILPMIKYLESFGVVFHYNTKVVNITFDIQKDKKAAKSIAVI.RDGQGEKIDLTENDLVFITNGGCVENSSYGSQDKAAVFNCEIREGGGWDMWRQIAKQDPSFGHPDKFCYDPEQTNW-MSATVTTLDDKIPPYIQKICKRDPFSGKIVTGGIVTVRDSNWLMSWTINRQPQFHNQPKDQLVVWVYALFSDKEGDYIKKPMRDCTGKEICAEWLYHLGVPLSEIDEMA.KKSAKTVPCMMPYITAFFMPREEGDRPDVVPQGAVNFAFLGQFAQT----KRDTIFTTEYSIRTGMEAVY
DSQ  GAACACAAATCGGCTTATATTATTGGTTCTGGTTTGGCCGCTCTGTCTGCTGCCTGTTTTCTAGTTCGCGATGGACAAATGCCCGGTAAACAAGTGCATATTTTGGAAAAAGATCCCATTCCTGGTGGTGCTTGTGATGGTTATCAATACAGTGATATTGGTTATGTGATGCGTGGCGGTCGTGAGATG---GACAATCATTTTGAATGTATGTGGGACTTATTTCGTTCAATTCCGTCTATTGAAACGGAAGGCGTAAGTGTTCTTGATGAATATTACTGGCTCAATAAAGCAGACCCCAACTATTCGCTTTGCCGTGCAACGAAAAAGCAAGGACAAGATGCCCATACTGATAAAAAATTTACCTTGTCCGATAAAGGGGCCAAAGAGATTATGCATTTATTCTTCACACCAGACGAAGATTTATATAATAAACGTATTAACGAAGTTTTTGATGGTGAAGTCTTTGATTCTAATTTCTGGCTTTATTGGCGGACAATGTTTGCTTTTGAAAATTGGCATTCTGCCTTAGAAATGAAACTTTATCTGAAGCGCTTCATTCATCATATTAGTGGCTTGCCTGACTTTACGGCTTTGCGCTTCACAAAGTACAATCAATACGAATCGATGATTTTGCCAATGATCAAATATCTTGAGTCATTTGGGGTTGTGTTTCATTACAATACTAAGGTGGTTAATATTACATTTGATATTCAAAAAGATAAAAAAGCAGCTAAAAGTATCGCAGTGATT...CGTGATGGCCAAGGCGAAAAAATTGACTTGACAGAAAATGATCTAGTTTTTATTACAAATGGCGGCTGTGTAGAAAATTCAAGCTATGGCAGTCAGGATAAAGCGGCAGTCTTTAATTGTGAGATTCGTGAAGGCGGTGGTTGGGATATGTGGCGTCAAATTGCTAAGCAAGATCCCTCTTTTGGGCATCCTGATAAATTCTGCTATGATCCTGAGCAGACAAATTGG---ATGAGCGCAACCGTGACAACTTTGGATGATAAGATTCCGCCATACATTCAAAAAATTTGTAAACGGGATCCATTCTCAGGAAAGATCGTGACAGGTGGTATTGTTACTGTTCGTGATTCTAATTGGTTAATGAGCTGGACCATCAATCGTCAGCCGCAATTCCATAACCAACCTAAAGATCAGCTGGTTGTTTGGGTTTATGCGCTCTTTTCTGATAAAGAAGGAGATTATATTAAAAAACCAATGAGGGATTGTACGGGAAAAGAAATATGCGCAGAATGGCTCTATCATTTAGGTGTTCCTCTATCAGAAATTGATGAAATGGCT...AAAAAAAGTGCCAAGACTGTTCCTTGTATGATGCCCTATATTACAGCTTTCTTTATGCCAAGAGAAGAGGGAGATCGTCCAGATGTAGTTCCACAAGGTGCTGTTAATTTTGCCTTTTTAGGACAATTTGCACAAACA------------AAAAGAGATACAATCTTTACGACGGAATATTCTATTCGGACAGGGATGGAAGCTGTTTAT
TRN  10010101100011000
NAM  Q8Y9P3_LISMO/47-535
ASQ  GDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCRGGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDAHS-MGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLFEFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF-----KDAPGITATAlHLSDESTIELGPDDDVIMTNACMTDSATLGDMNTPAPKPEEK--PISGELWYKVAQKKPNLGNPEPFFAHEEETNW-QSFTVTCHGDKLLKRIERFTGNIP-----GSGALMTFKDSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCHLNWQDDFEEIKA.-DIINVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEI----PKDMVFTEEYSVRAARIAVY
DSQ  GGTGACAAACAAGTGTATTTCGTCGGTGGCGGGATTGCTAGTTTGGCGGGGGCTGTTTATTTAATTCGTGATGCCAATTTTGATGGGAAAAATATTCATATTATTGAAGGGATGCATATTTTAGGCGGAAGTAATGACGGAGCTGGAAGCGTGGAACATGGCTTTGTTTGCCGTGGTGGTCGGATGTTGAATGAAGAAACCTATGAAAATTTCTGGGATTTATTTAGTAGTATTCCGTCGCTTGATATGCCGAACTTTAGTGTGACAGAAGAGATTTTGAACTTTGACCATTTACATCCAACCCATGCGCAAGCGAGATTAGTTGATAAAGATCGCAATATCCTCGATGCGCATTCG---ATGGGATTTAATAATAATGACCGGATGTTGATGACGAAACTGCTCGCTACTCCGGAAGAAAAACTTGATAATTTAACGATACGTGATTGGTTTGACGAACACTTTTTCGAAACGAATTTTTGGTATATGTGGCAAACCACTTTTGCTTTCCAAAAATGGAGCAGTTTATTCGAATTTAGACGTTATATGAACCGAATGATGTTAGAATTTAGTCGGATTGATACGCTAGAAGGTGTAACAAGAACGCCGCTAAACCAATACGAAAGCTTGATTTTACCTTTAAAAACATTTTTAGATAAACATCATGTTGATTTTACGATTAATCAAACGGTGGAAGATATCGATTTT---------------AAAGATGCGCCTGGAATTACAGCGACAGCActtCATTTATCGGATGAATCAACTATTGAACTTGGCCCAGACGATGACGTGATTATGACGAATGCATGTATGACGGATAGTGCGACACTCGGCGATATGAATACGCCAGCACCGAAACCAGAAGAAAAA------CCAATTTCCGGGGAGCTTTGGTATAAAGTCGCGCAAAAGAAACCAAATTTAGGGAATCCAGAGCCATTCTTCGCTCATGAGGAAGAAACAAATTGG---CAAAGCTTTACCGTCACTTGTCATGGTGATAAATTATTAAAACGTATCGAACGCTTCACTGGAAATATTCCG---------------GGAAGTGGCGCGCTTATGACATTTAAAGATTCCAATTGGCTTATGAGTACGGTTGTTGCTGCACAACCACATTTTAAAGCGCAAGATGCGAATACTACGATTTTCTGGGGTTACGGATTATATCCAGACCGCGTTGGTGATTTCGTGAAAAAACCAATGAAAGAATGTACTGGGGAAGAAATTTTATATGAATTAATGTGTCATTTGAACTGGCAAGATGATTTTGAAGAAATTAAAGCG...---GATATAATCAATGTAATTCCGTGCTATATGCCGTACATTGACGCGCAATTCGAACCGCGGGCAATGAGCGATCGTCCGGCTGTTGTTCCGGAGGGCAGTACAAACTTCGCGATGATTAGCCAATTTGTGGAAATT------------CCAAAAGATATGGTTTTCACCGAAGAATATTCCGTTCGCGCTGCTAGAATCGCCGTGTAT
TRN  10010101100011000
//