EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06068 - TIP49)
FAM  PF06068
PID  TIP49
DES  TIP49 C-terminus
IPR  IPR010339
ANO  17
ALN  328
AID  0.478985
APH  (((((((((((Q9C0X6_SCHPO/118-441:0.14570,((Q8WZS3_NEUCR/118-441:0.16107,Q03940_YEAST/126-449:0.20164):0.02960,O17607_CAEEL/136-440:0.37862):0.03546):0.07118,RUVB1_XENLA/117-440:0.13298):0.10496,(Q8IIU3_PLAF7/136-459:0.38996,Q8IAT2_PLAF7/188-504:0.43242):0.08438):0.08494,Q8STP2_ENCCU/109-426:0.58427):0.32757,(O28462_ARCFU/117-432:0.40996,Q9YFB5_AERPE/141-458:0.42572):0.15794):0.22170,Q8SU27_ENCCU/111-409:0.57435):0.14061,Q9GZH2_CAEEL/120-432:0.35041):0.06789,Q12464_YEAST/122-433:0.18576):0.04555,Q8ID85_PLAF7/117-433:0.30050):0.03695,RUVB2_XENLA/123-435:0.13454):0.13100,Q9M2X5_ARATH/120-434:0.16060,Q9FJW0_ARATH/120-433:0.02318);
ATP  (((((((((((Q9C0X6_SCHPO/118-441,((Q8WZS3_NEUCR/118-441,Q03940_YEAST/126-449),O17607_CAEEL/136-440)),RUVB1_XENLA/117-440),(Q8IIU3_PLAF7/136-459,Q8IAT2_PLAF7/188-504)),Q8STP2_ENCCU/109-426),(O28462_ARCFU/117-432,Q9YFB5_AERPE/141-458)),Q8SU27_ENCCU/111-409),Q9GZH2_CAEEL/120-432),Q12464_YEAST/122-433),Q8ID85_PLAF7/117-433),RUVB2_XENLA/123-435),Q9M2X5_ARATH/120-434,Q9FJW0_ARATH/120-433);
ATL  6.54216
DNO  17
DLN  984
DID  0.523669
DPH  (((((((((((O17607_CAEEL/136-440:0.31543,(RUVB1_XENLA/117-440:0.21706,Q8WZS3_NEUCR/118-441:0.26953):0.07563):0.04665,Q9C0X6_SCHPO/118-441:0.19619):0.07781,Q03940_YEAST/126-449:0.23729):0.08571,(Q8IIU3_PLAF7/136-459:0.26973,Q8IAT2_PLAF7/188-504:0.28679):0.14410):0.16546,Q8STP2_ENCCU/109-426:0.43696):0.11676,(O28462_ARCFU/117-432:0.30675,Q9YFB5_AERPE/141-458:0.37279):0.15534):0.12798,Q8SU27_ENCCU/111-409:0.41966):0.17024,(Q12464_YEAST/122-433:0.20420,Q8ID85_PLAF7/117-433:0.28452):0.08771):0.05892,RUVB2_XENLA/123-435:0.17380):0.05238,Q9GZH2_CAEEL/120-432:0.40904):0.11681,Q9M2X5_ARATH/120-434:0.14268,Q9FJW0_ARATH/120-433:0.07417);
DTP  (((((((((((O17607_CAEEL/136-440,(RUVB1_XENLA/117-440,Q8WZS3_NEUCR/118-441)),Q9C0X6_SCHPO/118-441),Q03940_YEAST/126-449),(Q8IIU3_PLAF7/136-459,Q8IAT2_PLAF7/188-504)),Q8STP2_ENCCU/109-426),(O28462_ARCFU/117-432,Q9YFB5_AERPE/141-458)),Q8SU27_ENCCU/111-409),(Q12464_YEAST/122-433,Q8ID85_PLAF7/117-433)),RUVB2_XENLA/123-435),Q9GZH2_CAEEL/120-432),Q9M2X5_ARATH/120-434,Q9FJW0_ARATH/120-433);
DTL  6.09809
RID  0.478985
RPH  (((((((((((Q9C0X6_SCHPO/118-441:0.14570,((Q8WZS3_NEUCR/118-441:0.16107,Q03940_YEAST/126-449:0.20164):0.02960,O17607_CAEEL/136-440:0.37862):0.03546):0.07118,RUVB1_XENLA/117-440:0.13298):0.10496,(Q8IIU3_PLAF7/136-459:0.38996,Q8IAT2_PLAF7/188-504:0.43242):0.08438):0.08494,Q8STP2_ENCCU/109-426:0.58427):0.32757,(O28462_ARCFU/117-432:0.40996,Q9YFB5_AERPE/141-458:0.42572):0.15794):0.22170,Q8SU27_ENCCU/111-409:0.57435):0.14061,Q9GZH2_CAEEL/120-432:0.35041):0.06789,Q12464_YEAST/122-433:0.18576):0.04555,Q8ID85_PLAF7/117-433:0.30050):0.03695,RUVB2_XENLA/123-435:0.13454):0.13100,Q9M2X5_ARATH/120-434:0.16060,Q9FJW0_ARATH/120-433:0.02318);
RTP  (((((((((((Q9C0X6_SCHPO/118-441,((Q8WZS3_NEUCR/118-441,Q03940_YEAST/126-449),O17607_CAEEL/136-440)),RUVB1_XENLA/117-440),(Q8IIU3_PLAF7/136-459,Q8IAT2_PLAF7/188-504)),Q8STP2_ENCCU/109-426),(O28462_ARCFU/117-432,Q9YFB5_AERPE/141-458)),Q8SU27_ENCCU/111-409),Q9GZH2_CAEEL/120-432),Q12464_YEAST/122-433),Q8ID85_PLAF7/117-433),RUVB2_XENLA/123-435),Q9M2X5_ARATH/120-434,Q9FJW0_ARATH/120-433);
RTL  6.54216
LNK  O17607_CAEEL/136-440:O17607:Z81042
LNK  O28462_ARCFU/117-432:O28462:AE000977
LNK  Q03940_YEAST/126-449:Q03940:Z48784
LNK  Q12464_YEAST/122-433:Q12464:Z73591
LNK  Q8IAT2_PLAF7/188-504:Q8IAT2:AL844507
LNK  Q8ID85_PLAF7/117-433:Q8ID85:AL844509
LNK  Q8IIU3_PLAF7/136-459:Q8IIU3:AE014837
LNK  Q8STP2_ENCCU/109-426:Q8STP2:AL590451
LNK  Q8SU27_ENCCU/111-409:Q8SU27:AL590450
LNK  Q8WZS3_NEUCR/118-441:Q8WZS3:AL669989
LNK  Q9C0X6_SCHPO/118-441:Q9C0X6:AL590902
LNK  Q9FJW0_ARATH/120-433:Q9FJW0:AB013390
LNK  Q9GZH2_CAEEL/120-432:Q9GZH2:AF039052
LNK  Q9M2X5_ARATH/120-434:Q9M2X5:AL132965
LNK  Q9YFB5_AERPE/141-458:Q9YFB5:BA000002
LNK  RUVB1_XENLA/117-440:Q9DE26:AF218072
LNK  RUVB2_XENLA/123-435:Q9DE27:AF218071
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8ID85_PLAF7/117-433
ASQ  RRSIGVRVKEESEVIEGEVVEIEIEKFNERD-.INNKNKKLGKMILKTTEMETLYDLGSKMIEALQKENITAGDVICIDKGTGKITKIGKSFARSKDYDAMDPNTLFVQCPEGELQKRKEVVHTVTLHDIDAINSRTQGFL.-------ALFSGDTGEIKNEIREHIDMKINEWQEDEKAEIVPGVLFIDEVHMLDIECFSYLNRALESEQSPIVIMATNRGITHIRGT-DYKAPHGIPLDLLDRTLIIPTYPYKHQDILKILEQRAEEEDVDIDEYAKELLCKIASESSLRYALHLITLANLVSKKRKATEVTVQDVRRVYNLFIDV
DSQ  AGAAGATCTATTGGTGTAAGAGTAAAAGAAGAATCAGAAGTAATAGAAGGAGAAGTAGTAGAAATTGAAATAGAGAAATTTAATGAAAGAGAT---...ATAAATAATAAAAATAAAAAATTAGGAAAAATGATATTAAAAACTACTGAAATGGAAACCTTATATGATTTAGGTAGTAAAATGATAGAAGCCTTACAAAAAGAAAATATTACTGCAGGAGATGTTATTTGTATTGATAAAGGTACAGGCAAAATTACCAAAATTGGAAAATCATTTGCTAGATCTAAAGATTATGATGCAATGGATCCAAATACCCTTTTTGTTCAATGTCCTGAAGGAGAATTACAAAAAAGAAAAGAAGTAGTACATACAGTTACTTTACACGATATTGATGCCATTAATAGTAGAACTCAAGGGTTCTTG...---------------------GCTTTATTTTCCGGGGATACTGGAGAAATAAAAAATGAAATCAGAGAACATATTGATATGAAAATTAATGAATGGCAAGAAGATGAAAAAGCCGAAATTGTACCAGGTGTCTTATTTATTGATGAAGTTCATATGTTAGATATTGAATGCTTTTCATATTTAAATAGAGCTTTAGAAAGTGAACAATCGCCAATAGTTATTATGGCAACAAATAGAGGTATTACACATATAAGAGGAACA---GATTATAAAGCTCCTCATGGAATTCCTTTAGATTTATTAGATAGAACACTTATTATACCAACTTATCCATATAAACATCAAGACATACTCAAAATCTTAGAACAAAGGGCAGAAGAAGAAGATGTTGATATTGATGAATATGCAAAAGAATTATTATGCAAAATTGCATCCGAATCCTCCTTAAGATATGCTTTACATTTAATTACCTTAGCAAATTTAGTATCAAAAAAACGTAAAGCAACAGAAGTTACGGTGCAGGATGTTAGACGTGTATATAACTTATTTATTGATGTT
TRN  10010101110011000
NAM  RUVB2_XENLA/123-435
ASQ  RRSIGVRIKEETEIIEGEVVEVQIDRPAT---.--GTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFL.-------ALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMSEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDE
DSQ  CGGAGGTCCATTGGTGTGAGGATCAAGGAAGAAACAGAGATCATTGAAGGGGAAGTTGTTGAAGTTCAGATTGATAGACCTGCCACT---------...------GGAACAGGTGCAAAAGTTGGTAAGCTGACTCTAAAGACAACTGAGATGGAGACCATTTATGATCTTGGAACAAAGATGATTGAGTCTTTAACAAAGGAAAAAGTACAGGCAGGGGATGTAATTACCATCGATAAAGCTACAGGCAAAATAACGAAGCTGGGTCGTGCCTTCACAAGGGCCCGGGATTATGATGCCATGGGATCTCAGACTAAGTTTGTTCAGTGCCCTGACGGGGAGCTTCAGAAGCGCAAGGAAGTCGTACATACTGTGTCACTGCATGAAATTGATGTGATAAACAGTCGGACGCAAGGATTCCTT...---------------------GCTCTCTTTTCAGGAGACACAGGGGAAATTAAATCAGAGGTGCGAGAACAAATCAATGCGAAAGTTGCAGAATGGAGAGAAGAGGGGAAGGCTGAAATTATTCCTGGTGTGCTATTCATAGATGAGGTTCACATGCTGGATATCGAATGCTTCTCCTTTCTGAATAGAGCTTTGGAAAGTGACATGGCCCCTGTTCTCATAATGGCCACAAACAGAGGAATAACCAGAATTCGTGGCACG---AACTACCAGAGTCCCCATGGAATTCCTATTGATTTATTGGATCGGTTACTCATTATCTCCACCTCGCCATACAATGAAAAAGAGACCAAACAGATCCTAAAGATCAGGTGTGAGGAGGAAGACGTGGATATGAGTGAAGATGCTTACACTGTTCTGACAAGGATCGGCCTAGAGACTTCTCTCCGATATTCCATGCAGCTTATCACAGCTGCTAGCTTGGTCTGTAGGAAGAGGAAGGGAACCGAAGTGCAAGTGGATGATATCAAACGGGTGTACTCTCTCTTTCTTGATGAG
TRN  10010101100011000
NAM  Q9FJW0_ARATH/120-433
ASQ  RKAIGVRIKEETEVIEGEVVEVQIDRPAS---.S-GVASKSGKMTMKTTDMETVYDMGAKMIEALNKEKVQSGDVIAIDKATGKITKLGRSFSRSRDYDAMGAQTKFVQCPEGELQKRKEVVHCVTLHEIDVINSRTQGFL.-------ALFTGDTGEIRSEVREQIDTKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENEMSPILVVATNRGVTTIRGT-NQKSPHGIPIDLLDRLLIITTQPYTDDDIRKILEIRCQEEDVEMNEEAKQLLTLIGRDTSLRYAIHLITAAALSCQKRKGKVVEVEDIQRVYRLFLDV
DSQ  CGTAAAGCGATTGGTGTTAGGATCAAAGAAGAGACAGAGGTTATTGAAGGAGAAGTTGTTGAGGTTCAGATTGATAGGCCTGCTTCT---------...TCT---GGTGTTGCTTCCAAGTCAGGGAAGATGACTATGAAAACGACTGATATGGAAACTGTGTATGATATGGGAGCTAAGATGATTGAGGCTTTGAACAAGGAGAAAGTGCAGAGTGGTGATGTTATTGCCATTGATAAAGCTACTGGGAAGATTACTAAGCTTGGAAGATCGTTTTCGAGGTCTCGTGATTATGATGCTATGGGTGCGCAGACCAAGTTTGTGCAGTGCCCTGAAGGTGAGTTGCAGAAGAGGAAAGAGGTTGTACATTGTGTCACTCTTCACGAGATTGATGTTATCAACAGCAGGACACAAGGGTTTCTT...---------------------GCCCTTTTCACTGGCGATACTGGAGAAATCCGATCAGAAGTCCGGGAACAAATTGATACAAAAGTAGCTGAATGGAGAGAAGAAGGAAAAGCAGAGATAGTTCCCGGAGTTCTCTTCATTGATGAAGTCCACATGCTCGACATCGAATGCTTCTCATTCCTTAACCGAGCTCTAGAAAACGAAATGTCACCAATCCTTGTGGTGGCAACAAACCGAGGAGTGACGACAATCCGTGGCACA---AACCAGAAATCACCACACGGGATCCCGATTGATCTCCTTGACCGTCTTCTCATCATCACTACCCAACCTTACACAGACGATGACATAAGGAAGATATTAGAAATCCGTTGCCAAGAGGAAGACGTTGAGATGAACGAAGAGGCCAAACAGCTTTTGACATTGATCGGACGTGATACATCTCTAAGGTATGCGATTCATCTTATAACCGCAGCTGCATTGTCATGCCAGAAACGGAAAGGGAAAGTCGTGGAGGTTGAGGATATTCAGAGAGTTTACAGACTGTTCTTGGATGTG
TRN  10010101100011000
NAM  Q9M2X5_ARATH/120-434
ASQ  RKAIGVRIKEETDVIEGEVVTISIDRPAS---.SGGSVKKTGKITMKTTDMESNFDLGWKLIEPLDKEKVQSGDVIVLDRFCGKITKLGRSFTRSRDFDVMGSKTKFVQCPEGELEKRKEVLHSVTLHEIDVINSRTQGYL.-------ALFTGDTGEIRSETREQSDTKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENDMSPILVVATNRGMTTIRGT-NQISAHGIPIDFLDRLLIITTQPYTQDEIRNILEIRCQEEDVEMNEEAKQLLTLIGCNTSLRYAIHLINAAALACLKRKGKVVEIQDIERVYRLFLDT
DSQ  CGTAAAGCTATTGGTGTTAGGATCAAAGAAGAGACTGACGTGATAGAAGGAGAAGTTGTGACGATTTCGATTGATAGACCTGCTTCT---------...TCTGGTGGTTCTGTGAAGAAGACTGGGAAGATAACAATGAAGACGACTGATATGGAATCTAATTTTGATTTGGGATGGAAATTGATTGAGCCATTGGATAAGGAGAAAGTACAGAGTGGTGATGTTATTGTTTTGGATAGGTTTTGTGGGAAGATTACTAAGCTTGGAAGATCTTTTACGAGGTCTAGAGATTTTGATGTTATGGGTTCAAAGACTAAGTTTGTGCAGTGCCCTGAAGGTGAGCTTGAGAAGAGGAAGGAGGTTTTGCATTCTGTCACACTTCATGAGATTGATGTTATTAATAGCAGGACTCAAGGGTATCTA...---------------------GCCCTCTTCACAGGTGATACAGGCGAGATTCGTTCAGAAACCCGAGAGCAAAGCGATACTAAAGTGGCAGAGTGGAGAGAAGAAGGGAAAGCTGAAATAGTACCTGGTGTTCTCTTCATTGATGAAGTCCATATGCTTGATATCGAATGCTTCTCTTTCCTGAATAGAGCTCTCGAAAACGATATGTCACCAATCCTGGTCGTGGCTACAAACAGAGGAATGACAACAATCCGAGGAACA---AACCAGATATCAGCACATGGGATCCCAATCGATTTTCTTGACCGTCTTCTTATTATCACAACACAGCCTTACACACAAGACGAGATCAGAAATATTTTAGAGATCCGTTGCCAAGAAGAGGATGTGGAGATGAACGAGGAAGCGAAACAGCTTCTGACTTTGATCGGATGTAATACCTCGCTTAGGTACGCGATTCATCTAATCAATGCAGCTGCCCTAGCTTGCCTGAAACGTAAAGGGAAAGTCGTAGAGATTCAGGACATTGAGAGAGTTTATAGATTGTTTTTAGACACC
TRN  10010101100011000
NAM  Q12464_YEAST/122-433
ASQ  RKSIGIKIKEETELIEGEVVEIQIDRSIT---.---GGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFL.-------ALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGT-NYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDS
DSQ  AGGAAATCCATCGGTATCAAAATCAAGGAGGAGACAGAATTGATTGAAGGTGAAGTCGTGGAAATTCAAATTGATAGATCTATTACT---------...---------GGTGGACACAAACAAGGAAAATTGACTATTAAAACTACCGATATGGAAACAATTTATGAATTAGGCAATAAAATGATTGATGGCCTAACTAAAGAAAAGGTATTGGCTGGCGATGTTATTTCTATTGATAAAGCTAGTGGGAAGATTACCAAGCTAGGCAGATCCTTTGCTAGATCTAGGGATTATGATGCCATGGGTGCTGATACCAGATTTGTTCAATGTCCGGAAGGCGAACTGCAAAAAAGGAAAACAGTGGTTCACACGGTGTCACTGCATGAAATTGATGTTATTAATTCAAGAACACAAGGATTTTTG...---------------------GCATTATTTACTGGTGACACCGGTGAAATTAGGTCAGAGGTAAGAGACCAGATAAACACAAAAGTGGCAGAATGGAAAGAAGAAGGTAAAGCAGAAATTGTTCCTGGTGTATTATTTATCGACGAAGTCCACATGTTGGATATAGAATGTTTTTCCTTTATAAATAGGGCTTTGGAAGATGAGTTTGCCCCAATCGTCATGATGGCTACAAATAGAGGAGTTTCCAAAACCAGAGGGACT---AATTACAAATCTCCACATGGGTTACCTCTCGATCTTTTGGATAGGTCAATTATTATTACAACTAAAAGTTATAATGAGCAGGAGATTAAGACAATTTTATCTATAAGAGCACAAGAGGAGGAAGTTGAACTGTCATCCGATGCCTTAGATCTATTGACCAAAACAGGTGTGGAAACTAGTTTGCGTTACAGCAGTAATTTAATCTCTGTTGCTCAGCAAATTGCAATGAAGAGAAAAAACAACACTGTTGAAGTGGAAGATGTCAAAAGGGCTTATTTGCTATTTTTGGACAGC
TRN  10010101100011000
NAM  Q9GZH2_CAEEL/120-432
ASQ  RRALGIQIKEETEVLEGEVISLEVDRSAN---.--GMGPKVGKLTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQGYV.-------ALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLIAASEVIRIRSKAEIVTTDHIGSAYRLFFDT
DSQ  CGACGTGCTCTGGGAATTCAGATTAAAGAAGAAACTGAAGTTTTGGAAGGAGAAGTGATCTCGTTGGAAGTTGATCGGTCAGCAAAT---------...------GGAATGGGACCAAAGGTCGGAAAACTCACAATGCGTACAACTGATATGGAAACTATCTACGATCTTGGATCAAAAATGGTTGATGCGTGTCTGAAAGAGAAAGTGATGCCCGGTGATGTTATTCAAGTTGATAAGGCTTCTGGACGTGTTACTCGACTTGGCCGTTCATTCAACCGTTCCCACGACTATGACGCAATGGGTCCAAAAGTGAAGCTTGTTCAGTGTCCAGATGGAGAAATTCAAAAGAGACGTGAAACTGTTCACACAGTTTGTCTTCACGACATTGACGTCATCAATTCTCGTACCCAAGGATACGTG...---------------------GCACTCTTCTCAGGAGACACTGGAGAGATCAAAGCAGAAGTGAGAGATCAGATTAATAAGAAGGTTTTGGAGTGGAGAGAAGAGGGAAAAGCAAAGTTTGTACCAGGAGTATTGTTTATTGATGAAGCTCATATGCTTGATATCGAATGCTTTTCGTTCCTCAACAGAGCCATCGAAGGCGAACTCAGTCCCTTGATTATCATGGCCACCAACAGATTGATCGAAAAAGTGCGTGGAACA---GATGTCGAATCTGCTCATGGCATCCCATCTGATTTCCTTGATCGTATGCTCATCATCAACGCGATCCCATATACTAAAGAAGATACAGCAAAGATTTTGTCAATTCGATGTGATGAAGAAGGAGTCAAATTGCAACCAACTGCCCTTGATCTTCTAGTGAAATTACAAGAAGCCACATCTCTTCGTTACTGTATTCATCTCATTGCTGCTTCTGAAGTTATTCGTATTCGCAGTAAAGCTGAAATTGTCACCACTGATCACATTGGATCAGCTTATCGTTTGTTCTTCGATACT
TRN  10010101100011000
NAM  Q8SU27_ENCCU/111-409
ASQ  RKSVGLRIKESVKVIEGEVVSL----------.------SGRRIVLKTVDMESSFEIGEKMRGELDKEKVSAGDVIRIVRERGRVYKIGTSMVKRS--DVVGTDTRFVPCPEGELIRITEETQEISLHDIDVVNSKAEGYL.-------ALFSGETGEIRAETRDEVNKKVWGWINEGKAEIVRGVLFIDEVHMLDIESFAFLNKAVEEDFCPVILVSTNKGECIVRGT-DEPSPYGIPRDFIDRALIISMEKHCRRDLEAILRHRILEEDILIDDDAVDRLVSISEASGLRYSMNLLTISSMRASRRNGR-VALGDVERAFELFLDE
DSQ  CGGAAATCTGTTGGGCTAAGGATCAAGGAGTCTGTGAAGGTTATTGAGGGGGAGGTTGTAAGCCTG------------------------------...------------------AGCGGAAGGAGGATTGTCCTCAAGACTGTCGACATGGAGTCTTCGTTTGAGATAGGAGAAAAGATGCGAGGCGAGCTTGACAAGGAGAAGGTGAGTGCAGGGGATGTCATCAGGATTGTCAGGGAAAGGGGAAGGGTGTACAAGATTGGAACAAGCATGGTGAAGAGGAGC------GATGTGGTGGGAACCGACACGCGATTTGTTCCCTGCCCCGAGGGGGAGCTGATAAGGATCACAGAGGAGACCCAGGAGATATCTTTGCACGACATCGATGTTGTTAACAGCAAGGCCGAGGGGTACCTT...---------------------GCACTTTTCAGCGGAGAGACTGGGGAAATCAGGGCAGAGACGAGAGACGAGGTGAACAAGAAGGTATGGGGCTGGATCAACGAGGGAAAGGCAGAGATAGTTCGGGGTGTCCTGTTTATCGACGAGGTTCACATGCTGGACATTGAAAGCTTTGCGTTTCTGAACAAGGCGGTGGAAGAGGATTTCTGCCCGGTAATCCTTGTTTCGACCAACAAGGGGGAATGCATTGTAAGAGGGACT---GACGAGCCAAGCCCGTATGGAATACCAAGAGACTTTATTGATCGTGCCCTGATCATTTCCATGGAGAAGCACTGTAGGAGAGATCTCGAGGCCATACTTAGGCACAGGATTCTCGAAGAGGACATTCTTATTGACGACGACGCCGTGGACAGGCTTGTTTCTATCTCTGAGGCATCCGGGCTGAGGTATTCTATGAACCTGCTAACAATATCAAGCATGAGGGCAAGCAGAAGGAATGGAAGA---GTAGCTCTCGGGGACGTCGAGAGGGCCTTCGAGCTGTTCCTTGACGAG
TRN  10010101100011001
NAM  Q9YFB5_AERPE/141-458
ASQ  RKAIGVRVRERREVVEGVVTSISVSKRRTPF-.SPYPVIAGARITLETKDESRTFTVGPEVAEQLVALGVRRGDVIVIDLETGVVRVVGRGKGRGQSFDI--DVVREVELPEGPVRKVKEFVRTLTLHDIDASIAAQRVAFtGLL----SMFEAERG-VTSEDRKKTDELVKKWVGEGKAEIVAGVIFIDDAHLLDMESFSFLSKAMESDLAPIIVLATNRGVAKIRGT-DIESPHGIPRDLLDRLLIITTRPYTRDEIKEIIRIRADEEEVLLSENALERLADIGSEKSLRYAIQLLEPAMIVAKRRGSRRVEAEHVEEAERLFADI
DSQ  AGAAAGGCTATTGGAGTTAGGGTTAGGGAGCGTAGGGAGGTTGTCGAGGGCGTTGTCACTAGCATATCAGTATCAAAGCGGAGGACGCCCTTC---...AGCCCCTACCCGGTGATAGCTGGCGCCAGGATAACCCTGGAGACGAAGGACGAGTCGAGAACCTTTACAGTGGGGCCAGAGGTGGCGGAGCAGCTTGTAGCCCTTGGAGTTAGGAGGGGTGACGTTATCGTGATCGACCTCGAGACCGGGGTGGTTAGAGTAGTCGGTAGAGGCAAGGGAAGGGGCCAGAGCTTCGATATT------GACGTGGTTAGGGAGGTTGAGCTTCCGGAGGGGCCTGTTCGCAAGGTTAAAGAGTTTGTTAGAACGCTAACGCTACACGATATAGACGCTAGCATAGCTGCTCAGAGGGTGGCGTTCactGGCCTCCTG------------AGTATGTTCGAGGCCGAGAGGGGG---GTCACCTCTGAGGATAGGAAGAAGACTGATGAGCTTGTTAAAAAGTGGGTTGGCGAGGGTAAGGCTGAGATAGTTGCTGGCGTAATATTCATCGACGACGCCCACCTACTCGACATGGAGTCCTTCTCGTTCCTATCGAAAGCCATGGAGAGCGATCTGGCACCCATAATTGTACTGGCCACAAACAGAGGGGTCGCCAAGATAAGGGGCACT---GACATAGAGAGCCCCCACGGCATACCCAGAGACCTACTAGACAGACTACTCATAATAACGACAAGGCCGTATACACGGGACGAGATTAAGGAGATAATCAGGATAAGGGCGGACGAGGAGGAGGTACTGCTGAGTGAGAACGCCCTCGAGAGGCTAGCAGACATAGGCTCCGAGAAAAGCCTGAGATATGCAATCCAGCTACTAGAGCCAGCGATGATAGTCGCCAAGAGGAGAGGCTCTAGGCGGGTTGAGGCAGAGCATGTCGAGGAGGCTGAAAGGCTCTTCGCCGACATC
TRN  10010101100011001
NAM  O28462_ARCFU/117-432
ASQ  RKAIGVRIRETRTVLEGEVVGLDYNMVPNPYN.PTQKIPESATLTLATKDEKRTFSVGGRLAMQFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDL--GDDEVVPVPSGKVEKEKEFTYVVTLHDLDEANARRTSIF.-------SLFSPPSREIDNEVREAVDEQVKRLVEEGRAELVPGVLFIDETHLMDIELFAFMNRAMESEMAPIIILASNRGFSRIRGT-DIVAPHGIPLDLLDRLLIITTEPYSREEIKTIIEIRAAESGIMLSNEAMEKLTDIGEKTSLRYAVQLLAPAYEFAKMRNSGKVELEDVERAASIFADV
DSQ  AGAAAGGCAATCGGTGTGAGGATAAGAGAGACGAGGACTGTGCTTGAAGGAGAGGTTGTTGGCCTCGACTACAACATGGTTCCCAACCCCTACAAC...CCCACACAGAAGATTCCTGAGTCTGCAACACTCACTCTGGCAACAAAGGATGAGAAGAGAACCTTCAGCGTTGGGGGAAGGCTTGCGATGCAGTTCTTCACTCAAGGAATCGAGGTTGGAGATGTCATAGTTATTGACAAGGAGACGGGGAGAATAGGGAAGCTTGGAAGGAGCGAGAAGGCGAAGAAGAAGTATGATCTG------GGGGATGATGAGGTCGTTCCCGTCCCATCGGGAAAGGTGGAGAAGGAGAAGGAGTTCACGTATGTTGTAACATTGCACGACCTGGATGAGGCAAATGCGAGAAGGACGAGCATATTC...---------------------AGCCTCTTCTCCCCGCCGAGCAGGGAAATCGACAATGAAGTTAGAGAAGCTGTGGATGAGCAGGTAAAGAGGCTCGTTGAGGAGGGCAGAGCTGAGCTTGTTCCGGGAGTGCTTTTTATCGACGAAACACATCTCATGGACATCGAGCTCTTTGCCTTCATGAACAGGGCAATGGAGTCGGAAATGGCGCCAATAATAATTCTCGCCTCCAACAGAGGATTTTCGAGGATTAGAGGGACC---GATATTGTTGCTCCGCACGGCATCCCGCTTGACTTGCTTGACAGGCTGCTGATCATCACGACAGAGCCCTACAGCAGGGAGGAAATCAAGACAATAATAGAGATAAGAGCAGCCGAGTCCGGAATAATGCTCAGCAACGAGGCGATGGAGAAGCTCACTGACATAGGGGAGAAGACGAGTTTGAGGTATGCGGTTCAGCTCCTCGCCCCAGCCTACGAGTTTGCCAAGATGAGAAACTCAGGAAAAGTGGAACTTGAGGACGTTGAGAGGGCTGCAAGCATCTTCGCTGATGTT
TRN  10010101100011001
NAM  Q8IAT2_PLAF7/188-504
ASQ  RKSIGVKIKEIKEVFEGEVVQIEPFFDNT---.YDEQKISYVHITLKTLKEQKKIKIHSSIYDNLLKEKIQEKDIIYIESHSGNVKRVGKCSLYQDMFDI--ETDTFVDLPKGNVHKKKNIIQNITLYDLDVSNVQPKDNIlDFL----QNNKSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNLAPVVILATNRGICNIKGT-NIISAHGIPVDLLDRIIIVKTMLYNKEEILQVLKLRCKFERIKIDSEALDYLSDIGIKCSLRYAIQLLTPAKILSKKKGKKKIDKNIIEIVSSIFFDT
DSQ  AGGAAGAGCATAGGTGTAAAAATTAAAGAAATAAAAGAAGTCTTTGAAGGAGAAGTAGTACAAATCGAACCTTTTTTTGATAATACC---------...TATGATGAACAAAAAATTTCATATGTTCATATTACTTTAAAAACATTAAAAGAACAAAAGAAAATTAAAATACACTCTTCTATATATGATAATCTATTAAAAGAAAAAATTCAAGAAAAAGATATTATCTATATTGAATCTCATAGTGGTAATGTTAAAAGAGTAGGGAAATGTAGTTTATATCAAGATATGTTTGATATA------GAAACTGATACTTTTGTTGATCTTCCTAAAGGAAATGTACATAAAAAAAAAAATATTATACAAAATATTACCCTATATGATCTAGATGTATCTAATGTACAACCGAAAGATAATATCctgGACTTTTTA------------CAAAACAACAAATCTAAAAAAACGGAAATTACTGATAAATTAAGAAATGAAATTAATAAAATTGTGTATAAATATGTGGATCAAGGAATAGCTCAAATTATACCAGGAGTATTATTTATTGACGAGGTACATATGTTAGATATTGAATGTTTTACATACTTGAACCGAACCTTAGAATCCAATTTAGCACCGGTCGTTATTTTGGCAACTAACAGAGGAATATGCAATATAAAAGGCACG---AACATAATATCTGCCCATGGTATTCCAGTAGATTTATTAGATAGGATAATAATTGTAAAGACTATGTTATATAATAAGGAGGAAATACTACAGGTTTTAAAATTGAGATGCAAATTTGAAAGAATAAAGATTGATAGTGAAGCCTTAGATTATTTATCAGATATAGGTATAAAATGCTCTTTGAGATATGCAATTCAACTATTAACCCCTGCAAAAATATTATCAAAAAAGAAAGGGAAAAAAAAAATTGACAAAAACATTATTGAAATTGTGTCTTCCATATTTTTTGACACA
TRN  10010101100011000
NAM  O17607_CAEEL/136-440
ASQ  RRAIGLRVKETKDVYEGEVTELSPVEASDNS-.GMGKTISHLVLSLKTAKGSKQLKLDPSIYDSILKQRVEVGDVIYIEANSGIVKRVGRCDVYASEFDL--EADEFVPMPKGDVRKSKDIVQNVSLHDLDIANARPQGRQgDVSNIVSQLMTPKKTEVTDRLRSEINKVVNEYIESGVAELMPGVLFIDEVHMLDVECFTYLYRALESPMAPVVVFATNRGTTTVRGL-GDKAPHGIPPEMLDRLMIIPTMKYNEEDIRKILVHRTEAENVQFEEKAFDLLTRLCAQTC------------------GREVIEVEDVDRCTKLFMDR
DSQ  AGAAGAGCTATTGGTCTGCGTGTTAAGGAAACCAAAGATGTGTACGAGGGAGAAGTTACAGAGTTGAGCCCCGTCGAAGCTTCAGATAATTCC---...GGAATGGGAAAAACCATCTCTCATCTTGTCCTTTCTTTGAAAACAGCAAAAGGAAGCAAGCAACTGAAATTGGATCCAAGCATCTATGACTCGATTTTGAAGCAACGAGTAGAAGTTGGTGATGTCATCTATATTGAAGCGAACTCAGGAATCGTTAAACGAGTTGGACGGTGTGATGTATATGCATCTGAGTTTGACCTC------GAGGCTGACGAGTTTGTGCCAATGCCGAAAGGAGATGTTAGAAAGTCTAAAGATATTGTTCAAAACGTGTCTTTGCATGATCTGGATATCGCAAATGCCCGTCCACAAGGACGTCAAggaGATGTTAGTAACATTGTTTCACAGCTGATGACTCCAAAGAAAACTGAAGTTACTGATCGTCTTCGTTCTGAAATCAACAAAGTAGTCAACGAATACATTGAAAGTGGAGTGGCTGAACTAATGCCTGGTGTTCTTTTCATCGACGAGGTTCATATGCTTGACGTAGAATGTTTTACCTATCTCTATCGCGCGCTCGAGTCCCCAATGGCACCCGTCGTGGTTTTTGCAACTAACCGTGGAACCACAACAGTTCGTGGACTC---GGCGATAAGGCACCACATGGAATTCCTCCAGAAATGCTCGATCGGCTGATGATTATTCCAACGATGAAGTATAACGAAGAAGACATCCGGAAGATTCTCGTTCATCGTACCGAAGCTGAAAATGTTCAATTCGAAGAAAAAGCATTTGATCTTCTAACTCGTCTTTGTGCTCAAACGTGT------------------------------------------------------GGAAGAGAGGTCATTGAAGTAGAGGACGTGGACCGTTGTACCAAATTGTTCATGGATCGT
TRN  10010101100011001
NAM  Q03940_YEAST/126-449
ASQ  RRAIGLRIKETKEVYEGEVTELTPEDAENPLG.GYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL--ETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQ.DVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDA
DSQ  AGAAGAGCAATTGGGTTAAGAATCAAAGAAACTAAGGAAGTTTATGAGGGTGAAGTGACAGAACTAACCCCTGAAGACGCAGAGAATCCGTTGGGC...GGATATGGTAAAACTATCTCACATGTAATTGTCGGGCTCAAGTCTGCCAAGGGTACCAAGACACTAAGATTAGACCCAACGATATATGAAAGTATTCAAAGAGAAAAGGTTAGTATTGGTGATGTCATTTATATAGAGGCCAACACCGGTGCAGTTAAGCGAGTTGGCAGATCTGATGCATACGCTACTGAATTTGATTTG------GAAACTGAGGAATACGTACCATTGCCAAAAGGCGAAGTGCATAAGAAAAAGGAAATTGTACAAGATGTTACCTTGCACGATTTGGATGTTGCAAACGCAAGACCACAAGGTGGTCAA...GATGTCATATCAATGATGGGCCAGTTGCTCAAACCTAAGAAGACTGAAATAACCGAGAAATTAAGACAAGAGGTGAATAAAGTTGTTGCTAAATATATTGATCAAGGTGTCGCAGAACTTATTCCAGGTGTTTTGTTCATTGATGAAGTTAATATGCTAGACATTGAAATATTCACGTATTTGAACAAAGCGCTTGAATCTAATATCGCCCCCGTTGTTGTATTGGCTTCTAATAGGGGCATGACTACAGTCCGTGGCACTGAGGATGTGATATCACCACATGGTGTGCCACCTGATTTGATCGATAGATTGTTAATTGTTCGTACATTACCATATGACAAGGACGAGATCCGTACCATTATAGAGAGAAGAGCTACCGTTGAAAGATTGCAAGTAGAAAGTAGCGCATTGGACCTTTTAGCCACGATGGGTACAGAAACTTCGTTACGTTACGCTTTACAATTATTGGCACCATGTGGTATCCTAGCACAAACAAGCAATCGTAAGGAAATTGTTGTTAATGACGTTAATGAAGCCAAATTGCTGTTTTTGGATGCC
TRN  10010101100011000
NAM  Q9C0X6_SCHPO/118-441
ASQ  RRAIGLRVKETKEVYEGEVTEMVPEEAENPLG.GYGKTISHVLLGLKTHKGTKQLKLDPSIYESLQREQVSTGDVIYIEANTGAVKRVGRSDAYATEFDL--EAEEYVPMPKGEVHKRKEIVQDVTLHDLDIANARPQGGQ.DIMSMMGQLMKPKKTEITDKLRGEINKVVNKYIEQGIAELIPGVLFIDEVHMLDIECFTYLNQALESTISPIVIFASNRGICTIRGTEDIQAPHGIPTDLLDRLLIVRTLPYSESEIRSILQIRAKVENIILTDECLDKLAQEGSRTSLRYVIQLLTPVSIIASLHGNKEIGVQDIEECNDLFLDA
DSQ  CGAAGGGCCATTGGTCTTCGGGTAAAGGAAACAAAAGAAGTGTATGAGGGTGAGGTTACAGAAATGGTTCCCGAAGAAGCCGAAAATCCTTTGGGC...GGTTATGGAAAAACCATTTCACACGTCCTTTTGGGCCTCAAAACGCATAAGGGTACCAAACAGCTCAAATTAGATCCTAGCATTTACGAATCTTTACAAAGAGAACAAGTGTCAACCGGGGACGTTATTTACATAGAAGCCAATACAGGTGCCGTAAAGAGAGTGGGTCGTAGCGATGCGTATGCTACGGAGTTCGATTTA------GAAGCGGAAGAATATGTTCCTATGCCTAAAGGTGAGGTACACAAGCGGAAAGAAATTGTTCAGGACGTGACTCTTCATGATTTGGATATTGCCAATGCCCGCCCTCAAGGAGGACAA...GATATAATGTCTATGATGGGTCAGTTAATGAAGCCCAAGAAAACTGAAATCACCGATAAGCTTCGTGGTGAAATTAACAAGGTTGTCAACAAATATATCGAACAAGGAATCGCTGAACTTATTCCTGGTGTCTTGTTCATCGACGAGGTTCATATGTTAGACATTGAGTGCTTTACTTATCTCAACCAAGCCCTAGAAAGCACTATTTCTCCTATTGTTATCTTTGCCTCTAATCGAGGCATTTGTACCATTCGGGGTACTGAGGATATTCAAGCTCCCCATGGTATTCCTACGGATTTGCTTGACAGATTACTAATAGTTCGCACACTCCCCTATTCAGAGTCAGAAATTCGTTCCATTTTGCAGATACGTGCAAAAGTTGAAAACATCATCCTTACTGATGAGTGTTTGGACAAGCTGGCTCAAGAAGGTTCTCGTACTAGTCTCCGTTATGTTATACAACTGTTGACACCCGTTAGCATTATTGCCAGTTTGCATGGTAACAAAGAGATTGGTGTACAAGATATCGAAGAATGTAACGATCTTTTCTTAGATGCT
TRN  10010101100011000
NAM  Q8WZS3_NEUCR/118-441
ASQ  RRAIGLKVRETKEVYEGEVTELTPEEAENPLG.GYGKTITTLLIGLKSAKGQKKLRLDPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDL--EAEEYVPIPKGEVHKKKEIVQDVSLHDLDVANARPQGGQ.DIMSMMGQLMKPKMTEITDKLRSEINKVVSKYIDQGVAELVPGVLFIDEAHMLDVECFTYLNKALESPISPIVVLASNRGMTGIRGAEDLVAAHGIPPDFLSRLLIIPTTAYDPEEIKRIVKIRSTTEGVKITEAAIDKIAEHGVRISLRYCLQLLTPASILAKVNGRNEIDVQDVAECEDLFLDA
DSQ  CGGCGCGCCATCGGCCTCAAAGTGCGCGAGACCAAGGAGGTGTACGAGGGCGAGGTGACGGAGCTGACGCCCGAGGAGGCCGAGAACCCGCTCGGC...GGCTACGGCAAGACCATCACCACGCTGCTGATTGGGCTCAAGAGCGCCAAGGGCCAGAAGAAGCTGCGTCTGGACCCGAGCATCTACGAGGCTATCCAGAAGGAGCGGGTCACGGTCGGCGACGTCATTTACATTGAGGCCAACACGGGCGCCTGCAAGCGCGTCGGCCGCTCCGACGCCTACGCTACCGAGTTCGATCTC------GAGGCGGAGGAGTACGTGCCTATCCCCAAGGGCGAGGTGCACAAGAAGAAGGAGATTGTGCAGGATGTGTCGCTGCATGATCTTGACGTGGCCAACGCCCGGCCCCAGGGCGGCCAG...GATATCATGTCCATGATGGGCCAGTTGATGAAGCCCAAGATGACGGAGATCACGGACAAGCTGCGGTCCGAGATCAACAAGGTGGTCAGCAAGTACATTGACCAGGGTGTAGCCGAGCTGGTTCCTGGCGTGCTGTTTATTGACGAGGCCCACATGCTGGACGTCGAGTGCTTCACGTACCTGAACAAAGCGCTCGAGTCGCCCATCTCCCCCATTGTCGTGCTGGCTTCGAACCGCGGCATGACCGGCATCCGCGGTGCCGAGGATCTCGTTGCCGCCCACGGCATTCCGCCCGACTTCCTCAGTCGTCTGCTCATCATCCCCACCACCGCCTACGACCCGGAGGAGATCAAGAGGATCGTCAAGATCCGCTCGACGACCGAGGGCGTCAAGATCACAGAGGCCGCTATTGACAAGATTGCGGAGCACGGTGTGCGCATCTCGCTTCGATACTGTCTCCAGCTGTTGACTCCTGCGAGCATTCTGGCCAAGGTCAATGGTCGCAACGAGATCGACGTCCAGGATGTCGCCGAGTGCGAGGACCTCTTCCTTGATGCT
TRN  10010101100011011
NAM  RUVB1_XENLA/117-440
ASQ  RRAIGLRIRETKEVYEGEVTELTPCETENPMG.GYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRSDTYATEFDL--EAEEYVPLPKGDVHQKKEVIQDVTLHDLDVANARPQGGQ.DILSMMGQLMKPKKTEITDKLRGQINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIFATNRGNCIIRGTEDVASPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEINELFYDA
DSQ  CGGAGAGCCATCGGACTGCGGATAAGAGAGACTAAGGAGGTGTATGAAGGAGAGGTGACAGAGCTGACTCCCTGTGAGACAGAGAATCCAATGGGA...GGATATGGCAAGACCATCAGTCATGTTATCATCGGACTGAAAACTGCAAAAGGAACCAAACAGCTAAAACTTGATCCTAGTATCTATGAGAGTCTACAGAAGGAGAGAGTAGAAGTTGGAGATGTGATCTACATTGAAGCAAACAGCGGAGCTGTAAAGCGGCAAGGCCGATCTGATACATACGCCACGGAATTTGACCTT------GAAGCTGAGGAGTACGTCCCCTTGCCGAAGGGAGATGTTCACCAGAAAAAAGAAGTGATTCAGGATGTCACCCTGCATGACCTGGATGTAGCCAATGCACGGCCACAGGGAGGACAG...GACATTCTGTCTATGATGGGACAGCTCATGAAGCCCAAGAAAACAGAAATTACAGATAAGCTGAGAGGGCAAATCAATAAAGTGGTGAACAAATACATTGACCAAGGCATAGCTGAACTTGTCCCGGGGGTGCTGTTTATAGATGAAGTACACATGTTGGATATAGAATGTTTTACATACCTCCACCGCGCTCTAGAGTCATCCCTTGCGCCCATCGTCATCTTCGCTACCAATCGTGGCAACTGCATCATTAGGGGCACAGAAGATGTGGCGTCTCCTCATGGCATACCCCTGGATCTGCTGGACAGAGTGATGATCATACGCACCATGCTGTATACACCGCAGGAAATGAAGCAGATCATTAAAATCCGAGCTCAGACAGAGGGGATTAACATTAGTGAAGAGGCCTTGAATCACCTGGGAGAAATCGGTACCAAGACAACATTAAGGTACTCTGTTCAGCTGCTCACCCCGGCTAACCTACTGGCCAAGATCAACGGCAAAGACAGTATCGAAAAAGAGCACGTGGAAGAAATAAATGAACTGTTCTATGATGCA
TRN  10010101100011000
NAM  Q8IIU3_PLAF7/136-459
ASQ  RKSIHIKIKEEKLVYEGEVVDMVVEENECLYSlNKAKQINAIIITLKSVKGSKTLRLAPKIHEQIAREKIKIGDVIYIETNTGHVKRLGRCNDYAKEYDI--EFDEYVSLPKGEVHKKKEVVQQISLHDIDLANANPTVGE.DLASVLNSYLRPKKTEITEKLRVEINKTVNKFLESGLAEIIPGVLYIDEAHMLDIECFSYLNRAIESPLAPILIMATNRGICTVKGT-DNIEPHGIPVDLLDRLIIIKTFPYTLKEIVQILALRAQTEKINITEEGMNYLAKIGIQSSLRFAMLLLEPSRILATLEGNTIIDIKHIEQADELFMDA
DSQ  AGAAAAAGTATACATATAAAAATTAAAGAAGAAAAATTAGTATACGAAGGAGAAGTTGTTGATATGGTTGTTGAAGAAAATGAATGTTTATATTCTttaAATAAAGCAAAACAAATTAATGCAATTATAATAACTTTAAAAAGTGTTAAAGGATCTAAAACATTAAGATTAGCACCAAAAATACATGAACAAATAGCTAGAGAAAAAATTAAAATAGGTGATGTTATTTATATAGAAACAAATACTGGACATGTCAAAAGATTAGGAAGATGTAATGATTATGCAAAAGAATATGATATA------GAATTTGATGAATATGTTTCCTTACCAAAAGGAGAAGTACATAAAAAAAAAGAAGTTGTTCAACAAATATCCCTACATGATATAGATTTAGCAAATGCAAACCCAACAGTTGGAGAA...GATTTAGCATCTGTTTTAAATTCCTATTTAAGACCTAAAAAAACCGAAATTACTGAAAAATTAAGAGTAGAAATTAATAAAACTGTAAATAAATTTTTAGAATCCGGATTAGCAGAAATTATACCTGGTGTTTTATATATTGATGAAGCACATATGCTAGATATAGAATGTTTCTCATATCTTAATAGAGCAATCGAATCTCCTTTAGCACCTATTCTTATTATGGCAACAAACAGAGGTATATGTACAGTTAAAGGTACT---GATAACATCGAACCTCATGGTATACCTGTAGATTTATTAGATAGACTTATTATTATTAAAACTTTTCCTTATACATTAAAAGAAATTGTACAAATATTAGCTCTTAGGGCACAAACAGAAAAAATCAATATTACTGAAGAAGGTATGAATTATCTAGCCAAAATCGGAATACAGTCATCTCTAAGATTTGCTATGTTATTATTAGAACCATCCAGAATTTTAGCTACCTTAGAAGGTAACACAATTATTGATATTAAACATATAGAACAAGCAGATGAATTATTTATGGATGCA
TRN  10010101110011000
NAM  Q8STP2_ENCCU/109-426
ASQ  RRSILVRMRELKDVYEGEVVELRIVDEENPLS.SYPKRIKEMFVILKTSKESKKLKLAPSLYEQIDKQRIVNGDVVYIEVNSGVIKKLGRSEAHMNDFDL--EADTYVPIPKGEVLKRKEVMQSVTLHDLDMANARPSGQ-.DMLSLVFRILSPRKTEITERLRGDVNRMVNGYLENGNAEIVPGVLFIDEVHMLDVECFTFLHKVIESPLSPTIIFASNKGMAPIKGSDGLLGPFGITKDLLDRIVIISVKRNPDEANREIIRRRMKEEGLEMDDDAFGFFVGLSTSRSLRYCISLIPLLKTY-----GGCVSVRNVEEVAELFHDS
DSQ  AGAAGATCGATTTTGGTGCGGATGAGGGAGTTGAAAGATGTCTATGAGGGGGAGGTTGTTGAGCTTCGGATTGTGGACGAAGAAAACCCGCTGAGC...TCCTACCCGAAGAGGATCAAGGAGATGTTTGTTATCCTGAAGACAAGCAAGGAGTCGAAAAAGCTCAAGCTTGCACCGTCCCTGTACGAGCAGATAGACAAGCAGAGGATTGTCAACGGAGATGTTGTGTACATCGAGGTCAACTCCGGGGTTATCAAGAAGCTGGGCAGGAGCGAGGCTCATATGAACGATTTCGATCTT------GAGGCTGACACATATGTCCCGATTCCTAAGGGAGAGGTTTTGAAGAGGAAGGAGGTGATGCAATCTGTAACATTGCATGACCTAGACATGGCAAATGCAAGGCCTTCTGGGCAG---...GACATGCTTTCCCTTGTTTTCCGAATACTGAGCCCCAGAAAGACGGAGATAACAGAAAGGTTGCGGGGTGATGTCAACAGGATGGTGAATGGATATCTGGAGAATGGCAATGCCGAGATTGTCCCTGGGGTTCTTTTCATCGACGAGGTCCATATGCTTGATGTTGAGTGCTTCACCTTTCTCCACAAGGTCATTGAATCTCCTCTCAGCCCGACGATAATATTTGCCTCCAACAAGGGAATGGCACCCATAAAGGGGAGCGACGGACTCCTCGGGCCCTTCGGAATCACTAAGGACCTTCTTGACAGGATTGTGATTATCAGTGTGAAGAGAAATCCGGATGAGGCCAACCGAGAAATTATCAGGAGGAGGATGAAGGAAGAGGGGTTGGAGATGGACGACGATGCATTTGGATTTTTTGTGGGCCTGAGCACCTCGAGGAGCCTACGATATTGCATAAGCCTTATTCCTCTCCTGAAGACATAT---------------GGGGGATGTGTCAGCGTCCGAAATGTAGAGGAGGTGGCAGAGCTATTCCACGACAGT
TRN  10010101100011011
//