EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06048 - DUF927)
FAM  PF06048
PID  DUF927
DES  Domain of unknown function (DUF927)
IPR  IPR009270
ANO  6
ALN  303
AID  0.672878
APH  (Q93IE4_STAAU/1-300:0.18062,Q8VUU9_STAAU/1-301:0.10257,(Q99XD2_STAAM/1-300:0.41697,((Q8VUV5_STAAU/1-300:0.13182,Q8VUX3_STAHO/1-301:0.20726):0.10445,Q8CU73_STAEP/1-302:0.18741):0.08375):0.10498);
ATP  (Q93IE4_STAAU/1-300,Q8VUU9_STAAU/1-301,(Q99XD2_STAAM/1-300,((Q8VUV5_STAAU/1-300,Q8VUX3_STAHO/1-301),Q8CU73_STAEP/1-302)));
ATL  1.51983
DNO  6
DLN  909
DID  0.664329
DPH  (Q93IE4_STAAU/1-300:0.26702,Q8VUU9_STAAU/1-301:0.06785,(Q99XD2_STAAM/1-300:0.43784,((Q8VUV5_STAAU/1-300:0.12797,Q8VUX3_STAHO/1-301:0.16686):0.05536,Q8CU73_STAEP/1-302:0.15752):0.06363):0.10173);
DTP  (Q93IE4_STAAU/1-300,Q8VUU9_STAAU/1-301,(Q99XD2_STAAM/1-300,((Q8VUV5_STAAU/1-300,Q8VUX3_STAHO/1-301),Q8CU73_STAEP/1-302)));
DTL  1.44578
RID  0.672878
RPH  (Q93IE4_STAAU/1-300:0.18062,Q8VUU9_STAAU/1-301:0.10257,(Q99XD2_STAAM/1-300:0.41697,((Q8VUV5_STAAU/1-300:0.13182,Q8VUX3_STAHO/1-301:0.20726):0.10445,Q8CU73_STAEP/1-302:0.18741):0.08375):0.10498);
RTP  (Q93IE4_STAAU/1-300,Q8VUU9_STAAU/1-301,(Q99XD2_STAAM/1-300,((Q8VUV5_STAAU/1-300,Q8VUX3_STAHO/1-301),Q8CU73_STAEP/1-302)));
RTL  1.51983
LNK  Q8CU73_STAEP/1-302:Q8CU73:AE016744
LNK  Q8VUU9_STAAU/1-301:Q8VUU9:AB063173
LNK  Q8VUV5_STAAU/1-300:Q8VUV5:AB063172
LNK  Q8VUX3_STAHO/1-301:Q8VUX3:AB063171
LNK  Q93IE4_STAAU/1-300:Q93IE4:AB037671
LNK  Q99XD2_STAAM/1-300:Q99XD2:BA000017
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q93IE4_STAAU/1-300
ASQ  M-T-NIIFSEYPYWLTEDSWYEVIPPKGKNDQQKSIRLSSPILIKNKFLDPKSGVEKLVISNGQNIGRIETSDILTSQKLPSLIMYGFSINEKYIKSLSNALQLMRQSLPLSSLYTGVGVLNTDK.GVVISLDEPYLSKEITQSQADEIICETQYDLQPKGTFEDWWQMYLDEVKGNLLLELAVVFGISSLVTAFLKTKHEVEFAGTIFSFTGNSSTGKSTAAALGVSITGNPTKGSNTLFRSWNGTRNALEGYLSNNYGVPIVLDELSSATFKDTTGLLYSIAEGQGRQRSNIHGEVKSLKN
DSQ  ATG---ACT---AACATCATCTTTAGTGAATATCCATACTGGCTTACTGAAGATTCATGGTATGAAGTTATACCACCGAAAGGTAAAAATGATCAGCAAAAGTCCATACGCTTATCTAGTCCAATTTTAATTAAAAACAAGTTTCTTGACCCCAAATCTGGGGTTGAGAAACTAGTTATTTCCAACGGACAAAATATTGGACGTATTGAAACATCAGATATTTTAACATCGCAAAAGTTACCTTCACTAATCATGTATGGCTTCAGCATCAATGAGAAGTACATTAAATCATTAAGCAATGCACTACAATTAATGCGCCAATCACTGCCTCTGTCATCGTTGTATACGGGTGTCGGTGTGTTAAATACTGATAAA...GGTGTCGTCATTTCATTAGATGAACCATATCTTTCAAAAGAAATTACACAGTCGCAGGCGGATGAAATCATTTGTGAAACACAGTACGATCTACAACCTAAAGGCACTTTTGAAGACTGGTGGCAAATGTATCTTGATGAAGTAAAAGGAAACTTGTTACTCGAACTTGCTGTAGTGTTTGGTATTTCTTCATTAGTAACTGCGTTTTTAAAAACAAAACATGAGGTTGAATTCGCAGGTACGATTTTCTCATTTACGGGAAATTCAAGCACGGGTAAATCAACTGCAGCGGCTTTAGGAGTCTCAATAACCGGCAACCCTACTAAAGGTAGTAATACGCTGTTTAGATCATGGAATGGCACTAGAAACGCGCTTGAAGGATATCTAAGTAACAACTATGGTGTACCTATTGTATTGGACGAACTGTCATCTGCAACCTTTAAAGATACAACTGGTTTGCTCTATTCAATTGCCGAAGGTCAAGGAAGACAACGTTCTAATATACACGGAGAAGTCAAGTCACTAAAAAAC
TRN  10010101100011000
NAM  Q8VUU9_STAAU/1-301
ASQ  M-N-NNIFKQYPYFLNSNGFYEVIPPKSNNDVEKIIQLSSPIIIENKFLDPSTGVEKLIITDGKNIERIEASDILTSFKLPGLIKYGFNINERYIKSLSYALQSMRQSLPLSKLYTGVGVLQSDDeGMVISLDKPYFSKEIEQSQANEIICETHYDLQPKGTFKGWWEMYLKQVKGNLLLELAVIFGISALVTSFLRHKHATEFAGIIFSFTGQSSTGKSTAASLAVSVAGNPTKGNETLFRSWNATRNALEGYLSNNYGIPIVFDELSSATFRDTTGLLYSITEGQGRQRSNVHGEVKTPKN
DSQ  ATG---AAT---AACAACATATTCAAGCAATATCCATATTTTTTAAATTCAAATGGCTTTTATGAAGTGATTCCACCTAAAAGTAACAATGATGTAGAAAAAATCATTCAATTGTCTAGTCCCATCATTATTGAAAATAAATTTCTCGACCCGTCTACAGGGGTTGAGAAGTTAATTATTACAGATGGAAAAAATATTGAACGTATTGAAGCATCAGATATCTTAACATCTTTCAAGCTACCTGGATTGATTAAGTACGGCTTCAACATCAATGAACGGTACATTAAATCATTAAGCTATGCGTTACAATCGATGCGCCAGTCACTTCCATTATCTAAATTATATACCGGCGTAGGTGTATTACAGTCTGATGATgaaGGTATGGTCATTTCATTGGATAAACCATACTTTTCAAAAGAAATAGAGCAATCTCAAGCTAATGAAATCATTTGTGAAACACACTATGATTTACAACCAAAAGGTACTTTCAAAGGCTGGTGGGAGATGTACTTAAAACAAGTTAAAGGGAACTTACTACTAGAACTTGCTGTAATATTTGGTATTTCTGCCTTAGTGACAAGTTTTCTGAGGCACAAACATGCAACCGAATTTGCCGGAATCATTTTTAGTTTTACAGGTCAATCCTCAACCGGTAAGTCAACTGCAGCTTCTTTAGCTGTATCAGTCGCTGGTAACCCTACCAAAGGTAATGAAACTCTTTTTAGAAGTTGGAATGCCACACGAAACGCACTTGAAGGTTACTTGAGTAACAATTATGGCATACCTATTGTATTTGACGAACTCTCGTCAGCAACTTTTAGAGATACAACGGGGTTATTGTACTCCATCACTGAAGGTCAAGGTCGTCAACGTTCAAACGTTCATGGAGAAGTTAAAACGCCTAAGAAT
TRN  10010101100011000
NAM  Q8CU73_STAEP/1-302
ASQ  MAQTNLSFNPSPRYKSKKGWYKDTPPKEKGGMPTEVEIAGPIVIENKFIDPKTNTEKLIITDEDQKEIVESSDILTTQKLPSLMKYGFSINEKYTKDLGYALQQMRNQLPISYLYEGVGILETPF.GPIVSLSEIYTTKEFDNKSPSDAICDNAYDLTPKGTFDNWFNMYLKEVKGSLLLELAVVFGISALVTSFLKHKHETEFAGIIFSFTGQSSTGKSTAASLAVSVAGNPTKGNETLFRNWNATRNALEGYLSNNFGIPIVFDELSSATFRDTTGLLYSITEGQGRQRSNVHGEVKTPKN
DSQ  ATGGCTCAAACTAACCTTTCATTTAATCCTTCACCACGATACAAATCAAAAAAAGGTTGGTATAAAGACACGCCCCCAAAAGAAAAAGGAGGAATGCCTACTGAAGTTGAAATCGCAGGTCCTATCGTTATCGAAAATAAGTTTATTGACCCTAAAACTAATACTGAAAAACTAATTATCACAGACGAAGATCAAAAAGAAATTGTTGAATCTAGTGATATTTTAACGACACAAAAACTGCCATCTTTAATGAAGTATGGATTTAGTATTAATGAAAAATATACAAAAGATTTAGGTTATGCGTTGCAACAAATGCGCAATCAATTACCCATTTCCTACTTATATGAAGGGGTAGGTATACTGGAAACACCGTTT...GGTCCTATTGTATCGTTAAGTGAAATCTATACTACTAAAGAATTTGATAATAAATCTCCATCTGACGCCATTTGTGATAATGCTTATGACTTAACTCCTAAAGGTACATTTGATAATTGGTTTAACATGTATCTAAAAGAGGTTAAAGGTTCTCTTCTTTTAGAATTAGCAGTCGTATTTGGTATTTCTGCCTTAGTGACGAGTTTCCTGAAGCACAAACATGAAACCGAATTTGCCGGAATCATTTTTAGTTTTACAGGTCAATCCTCAACCGGTAAGTCAACTGCAGCTTCTTTAGCTGTATCAGTCGCTGGTAACCCTACCAAAGGTAATGAAACTCTCTTTAGAAATTGGAATGCCACACGTAATGCACTTGAAGGTTACTTGAGTAACAATTTTGGTATACCTATTGTATTTGATGAACTCTCATCAGCAACTTTTAGAGATACAACGGGGTTATTGTACTCCATCACTGAAGGTCAAGGTCGTCAACGTTCAAACGTTCATGGAGAAGTTAAAACGCCTAAGAAT
TRN  10010101100011000
NAM  Q8VUX3_STAHO/1-301
ASQ  M-SHHDIFRLGLYHLDTMGWHKTILPKKDGDEKKVVTMSSCIAVEAKFWHASENTEKIIISNGKDKEHTFESDILTARKLPSLIKYGHSINENYIKDLSYALQLMRDELPTSDLYDGSGIIETPH.GYIVMIDTIYTSKQYDQLSSLDPIVDSAYPLEPKGTFKDWLNMYINEVKGHLLLELAVVFGISALVTSFLKYKREIEFAGIIFSFTGQSSTGKSTAAALAVSVAGNPTKGNQTLFRGWNATRNALESYLSNNFGIPIVFDELSSATFKDTTGLLYSIAEGQGRQRSNVHGEVKTPKN
DSQ  ATG---AGTCATCATGACATTTTTAGACTAGGCCTATACCATTTAGATACAATGGGTTGGCATAAAACTATTCTACCTAAAAAAGATGGAGATGAGAAAAAAGTGGTGACTATGTCTAGTTGTATCGCTGTTGAAGCTAAATTTTGGCATGCCTCAGAAAATACAGAAAAGATAATTATTTCTAACGGTAAAGATAAAGAACATACATTTGAATCTGATATTTTAACAGCTCGAAAGTTACCTTCCTTGATTAAATATGGTCACAGTATCAATGAAAATTATATAAAAGATTTGAGCTATGCACTACAATTAATGCGCGATGAACTGCCCACTTCTGATTTATATGATGGCTCGGGCATTATAGAAACACCCCAC...GGTTATATTGTAATGATAGATACCATTTATACATCTAAACAATATGATCAATTATCATCTTTAGATCCTATTGTCGATAGTGCTTATCCATTAGAGCCTAAAGGTACATTTAAAGATTGGTTAAATATGTATATTAACGAAGTCAAAGGTCATCTTCTTCTAGAGTTAGCGGTCGTATTTGGAATTTCTGCCTTAGTGACAAGCTTTCTGAAGTACAAACGTGAAATCGAATTTGCAGGAATTATCTTTAGTTTTACAGGCCAGTCATCAACTGGTAAATCAACAGCAGCAGCTTTAGCAGTATCCGTCGCTGGAAATCCAACTAAAGGTAATCAAACACTTTTTCGAGGTTGGAATGCCACACGTAATGCACTTGAAAGTTACTTGAGTAACAATTTTGGTATACCTATTGTATTTGATGAACTCTCATCAGCAACTTTTAAAGATACAACGGGGTTATTGTACTCTATCGCTGAAGGTCAAGGGCGTCAACGTTCCAATGTACACGGAGAAGTTAAAACGCCTAAGAAT
TRN  10010101100011000
NAM  Q8VUV5_STAAU/1-300
ASQ  M-S-YTLFEIGPFALDSFGWKETIPPKKDGDSEKVVRMASPIIVNARFSDPITGVEKLIITNNNGKKDIFESDILTTRNLPSLIKYGYSINEKYIRSLSYALQLMRDRLPLSELYEGVGILETPF.GYLISLDKVLKSIQFNQSSPSYPIVDSAYDLTPKGTFDNWFNMYIDEVKGHLLLELAVIFGISALVTSFLKHKHEIEFAGILFSFTGQSSTGKSTAAALAVSVAGNPTKGNETLFRSWNATRNALEGYLSNNYGIPIVFDELSSTTLRDTTGLLYSIAEGQGRQRSNVHGEVKTPKN
DSQ  ATG---AGT---TACACATTGTTTGAAATTGGCCCATTTGCTTTAGATTCCTTCGGTTGGAAAGAAACGATACCACCTAAAAAAGATGGTGACAGTGAAAAAGTGGTTAGAATGGCTAGCCCTATTATTGTTAATGCAAGATTTTCTGATCCAATTACTGGTGTTGAAAAGTTGATTATTACTAACAACAATGGTAAAAAAGACATTTTTGAGTCTGATATCTTAACAACACGAAACTTACCTTCTTTAATTAAATATGGCTACAGTATTAACGAGAAGTATATTAGATCATTGAGTTATGCCTTGCAATTGATGCGAGATAGATTACCACTTTCTGAATTATATGAGGGTGTAGGTATACTAGAGACACCTTTT...GGCTACTTGATATCGCTAGATAAAGTTCTCAAATCTATTCAATTTAATCAGTCCTCACCTTCATACCCTATTGTAGATAGTGCTTATGACTTAACTCCTAAAGGTACATTTGATAATTGGTTTAACATGTATATTGACGAGGTTAAAGGTCATCTTCTTTTAGAATTGGCAGTCATATTTGGGATTTCTGCCTTAGTGACAAGTTTTCTGAAGCATAAACATGAAATCGAATTTGCAGGAATTCTCTTTAGTTTTACAGGTCAATCCTCAACCGGTAAGTCAACCGCAGCTGCTTTAGCTGTATCAGTCGCTGGTAACCCTACCAAAGGTAATGAAACTCTTTTTAGAAGTTGGAATGCCACACGAAACGCACTTGAAGGTTATTTGAGTAACAATTATGGCATTCCTATAGTATTTGATGAGCTTTCATCTACGACACTTAGAGATACCACGGGTTTGTTATATTCCATCGCTGAAGGTCAAGGTCGTCAACGTTCAAACGTTCATGGAGAAGTTAAAACGCCTAAGAAT
TRN  10010101100011000
NAM  Q99XD2_STAAM/1-300
ASQ  MLMEKILYQTDEFKLKPSGWYKTIPPKKDGGTEFEIMLSGPIAFTDRFIDPATRKEKVFLSDLNNIELVEKASILTALQLPSLIEYGFTINEKHIRDLGFVLQQMRSTTPLSTIYSGVGMLHTLL.GPLISLDQPYFSNEITNSTS--IICDNKYDLIPKGNLSEWLQMYKEEVHGNLSLELDVLFGVSSLVTAFLKYHNNVEFSGTIFSFTGQSSTGKSTAAMLAASVAGNPTKGTENLFRSWNATRNALEGYLSGNYGVPIVLDELSAATFHDTTGLLYSFAEGQGRQRANINGDVKTPKN
DSQ  CTGTTAATGGAAAAAATTCTATATCAAACTGACGAATTCAAGCTCAAACCTTCGGGATGGTACAAAACCATCCCTCCTAAAAAAGATGGGGGTACGGAGTTTGAAATAATGTTATCTGGACCGATTGCTTTCACAGATCGTTTTATAGACCCCGCGACTCGTAAAGAAAAAGTATTTCTTTCGGATTTGAATAATATAGAGCTTGTCGAAAAGGCTTCAATCCTTACTGCTTTGCAATTACCCTCCTTAATTGAATATGGATTTACCATTAATGAAAAGCACATTAGAGATTTAGGGTTCGTACTGCAACAAATGAGAAGCACCACACCTTTATCAACAATATACTCAGGTGTAGGAATGCTTCATACATTACTT...GGACCATTAATTTCATTAGACCAGCCTTATTTTTCTAATGAGATTACTAATAGCACTTCT------ATTATATGTGATAACAAGTACGATTTAATACCAAAAGGCAATTTATCAGAATGGTTACAAATGTATAAAGAAGAAGTCCATGGGAACTTATCTTTAGAACTAGATGTGTTGTTTGGCGTATCTTCATTAGTCACTGCTTTCCTTAAGTATCATAATAACGTCGAGTTTTCAGGAACTATTTTCTCTTTCACTGGCCAATCATCAACAGGAAAATCGACAGCCGCTATGTTAGCCGCATCGGTAGCTGGCAACCCAACAAAAGGTACTGAAAACCTATTCCGGAGTTGGAATGCAACAAGAAATGCACTAGAAGGATATCTTAGCGGAAATTATGGTGTACCCATAGTATTAGATGAATTATCAGCGGCAACATTTCATGATACAACAGGTCTTCTATATTCATTTGCAGAGGGACAAGGACGTCAAAGAGCAAATATAAATGGTGATGTCAAAACACCTAAAAAC
TRN  10010101100011000
//