EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06035 - DUF920)
FAM  PF06035
PID  DUF920
DES  Bacterial protein of unknown function (DUF920)
IPR  IPR010319
ANO  11
ALN  190
AID  0.52619
APH  (((Q8U7U2_AGRT5/16-199:0.41857,Q98ND9_RHILO/18-202:0.28045):0.10059,(Q8G056_BRUSU/14-201:0.29055,(Q8FXW4_BRUSU/23-206:0.24524,(((Q8UIP1_AGRT5/21-204:0.25944,Q92ST4_RHIME/41-224:0.34069):0.14736,(Q98DU1_RHILO/16-204:0.24903,Q98NJ0_RHILO/19-202:0.24934):0.16853):0.06765,Q8FV24_BRUSU/2-184:0.71892):0.07131):0.05826):0.06888):0.21774,Q8UEK0_AGRT5/18-202:0.23961,Q92QC1_RHIME/18-200:0.25950);
ATP  (((Q8U7U2_AGRT5/16-199,Q98ND9_RHILO/18-202),(Q8G056_BRUSU/14-201,(Q8FXW4_BRUSU/23-206,(((Q8UIP1_AGRT5/21-204,Q92ST4_RHIME/41-224),(Q98DU1_RHILO/16-204,Q98NJ0_RHILO/19-202)),Q8FV24_BRUSU/2-184)))),Q8UEK0_AGRT5/18-202,Q92QC1_RHIME/18-200);
ATL  4.43967
DNO  11
DLN  570
DID  0.602627
DPH  (Q98DU1_RHILO/16-204:0.16897,((Q8FV24_BRUSU/2-184:0.49504,((Q8FXW4_BRUSU/23-206:0.18940,Q8G056_BRUSU/14-201:0.25868):0.04235,((Q98ND9_RHILO/18-202:0.17939,Q8U7U2_AGRT5/16-199:0.36044):0.06625,(Q92QC1_RHIME/18-200:0.17489,Q8UEK0_AGRT5/18-202:0.16809):0.13098):0.06396):0.03951):0.04760,(Q92ST4_RHIME/41-224:0.27946,Q8UIP1_AGRT5/21-204:0.18757):0.11791):0.09868,Q98NJ0_RHILO/19-202:0.20031);
DTP  (Q98DU1_RHILO/16-204,((Q8FV24_BRUSU/2-184,((Q8FXW4_BRUSU/23-206,Q8G056_BRUSU/14-201),((Q98ND9_RHILO/18-202,Q8U7U2_AGRT5/16-199),(Q92QC1_RHIME/18-200,Q8UEK0_AGRT5/18-202)))),(Q92ST4_RHIME/41-224,Q8UIP1_AGRT5/21-204)),Q98NJ0_RHILO/19-202);
DTL  3.26948
RID  0.52619
RPH  (((Q8U7U2_AGRT5/16-199:0.41857,Q98ND9_RHILO/18-202:0.28045):0.10059,(Q8G056_BRUSU/14-201:0.29055,(Q8FXW4_BRUSU/23-206:0.24524,(((Q8UIP1_AGRT5/21-204:0.25944,Q92ST4_RHIME/41-224:0.34069):0.14736,(Q98DU1_RHILO/16-204:0.24903,Q98NJ0_RHILO/19-202:0.24934):0.16853):0.06765,Q8FV24_BRUSU/2-184:0.71892):0.07131):0.05826):0.06888):0.21774,Q8UEK0_AGRT5/18-202:0.23961,Q92QC1_RHIME/18-200:0.25950);
RTP  (((Q8U7U2_AGRT5/16-199,Q98ND9_RHILO/18-202),(Q8G056_BRUSU/14-201,(Q8FXW4_BRUSU/23-206,(((Q8UIP1_AGRT5/21-204,Q92ST4_RHIME/41-224),(Q98DU1_RHILO/16-204,Q98NJ0_RHILO/19-202)),Q8FV24_BRUSU/2-184)))),Q8UEK0_AGRT5/18-202,Q92QC1_RHIME/18-200);
RTL  4.43967
LNK  Q8FV24_BRUSU/2-184:Q8FV24:AE014292
LNK  Q8FXW4_BRUSU/23-206:Q8FXW4:AE014291
LNK  Q8G056_BRUSU/14-201:Q8G056:AE014291
LNK  Q8U7U2_AGRT5/16-199:Q8U7U2:AE009364
LNK  Q8UEK0_AGRT5/18-202:Q8UEK0:AE009132
LNK  Q8UIP1_AGRT5/21-204:Q8UIP1:AE008997
LNK  Q92QC1_RHIME/18-200:Q92QC1:AL591787
LNK  Q92ST4_RHIME/41-224:Q92ST4:AL591783
LNK  Q98DU1_RHILO/16-204:Q98DU1:BA000012
LNK  Q98ND9_RHILO/18-202:Q98ND9:BA000012
LNK  Q98NJ0_RHILO/19-202:Q98NJ0:BA000012
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98NJ0_RHILO/19-202
ASQ  AVAGSA-----HAAPASMVVGGSTSQPIGHYDFCKIHVAECSIRSPDSVPEHLTSKLLHDISAVNLSVNTRVKPMSDMDNYGKDEWWAYPDNGFGDCEDYALEKRRELNSLGIAIANLLMTVVRKPDGEGHAVLTVRTDKGDFILDNLTDKVRLWNQTSYRYLKRQASDNTGHWVSILGGD-EQLVSAVK
DSQ  GCGGTGGCGGGTTCGGCC---------------CATGCCGCGCCTGCTTCCATGGTTGTCGGCGGCTCGACCTCCCAGCCGATCGGCCACTATGATTTTTGCAAGATCCATGTCGCCGAATGCTCTATCCGCTCGCCCGACAGTGTACCGGAACACCTGACCAGCAAGCTGCTGCACGATATCTCGGCCGTGAATCTCTCGGTCAACACGCGCGTCAAGCCGATGAGCGACATGGACAATTACGGCAAGGACGAATGGTGGGCCTATCCGGACAATGGTTTTGGCGACTGCGAGGATTACGCGCTGGAAAAGCGGCGTGAGCTCAACAGCCTGGGCATTGCCATAGCCAATCTTTTGATGACGGTGGTTCGCAAGCCTGATGGCGAGGGTCACGCCGTGCTGACGGTGCGCACCGACAAGGGCGACTTCATCCTCGACAATCTGACCGACAAGGTCCGCCTCTGGAACCAGACGAGCTATCGCTACCTGAAGCGGCAGGCGAGCGACAACACCGGGCACTGGGTCTCCATTCTGGGCGGCGAC---GAACAGCTGGTCAGCGCCGTCAAA
TRN  10010101100011011
NAM  Q98DU1_RHILO/16-204
ASQ  AAGLAATGSWPAMAAGAMATGGITSQPIGHYDFCKLHPGECSIRPSNLAPAKMTNGLMRKLAGVSARVNAAVKPMSDMDIYGKDEVWAYPDKGVGDCEDYVLEKRRRLSHMGISLADLLITVVRKTDGEGHSVLTVRTDKGDYVLDNLTDKVKAWDQTGYRFLKRQAIDNTGRWVSIRGGQ-QVLVGSVE
DSQ  GCGGCCGGTCTGGCAGCCACGGGAAGCTGGCCGGCAATGGCGGCCGGAGCGATGGCGACCGGGGGCATCACCTCGCAGCCGATCGGCCACTATGATTTCTGCAAGCTGCACCCCGGCGAATGCTCGATCCGTCCGAGCAATCTGGCGCCGGCAAAAATGACCAATGGGCTGATGCGCAAGCTTGCCGGCGTCTCCGCCAGGGTCAACGCCGCCGTCAAGCCGATGAGCGACATGGACATCTACGGCAAGGACGAGGTCTGGGCCTATCCCGACAAGGGCGTCGGCGATTGCGAGGACTACGTGCTGGAAAAGCGCCGCCGGCTGTCCCACATGGGCATCTCGCTGGCCGACCTGCTCATCACCGTGGTGCGCAAGACCGATGGCGAAGGCCATTCCGTGCTGACGGTGCGCACCGACAAGGGCGACTACGTGCTCGACAATCTGACTGACAAGGTCAAGGCCTGGGACCAGACCGGCTACCGCTTCCTCAAGCGGCAAGCGATCGACAACACCGGCCGCTGGGTCTCCATCCGCGGCGGCCAG---CAGGTGCTGGTCGGGTCGGTGGAG
TRN  10010101100011011
NAM  Q92ST4_RHIME/41-224
ASQ  NTAIPAQ----AGATPWMQTGAVTSQPIGHYEFCQKYRGECNVRSKAKVPPRVTAGGWAAIRQVNASVNRQIAPVTDIELTGRDEVWSYPGR-QGDCEDFALEKRRRLMQKGFSAGNLLMTVVRKPDGEGHAVLTVRTAQGDFILDNLDDGVRLWTHTPYRFLKRQATNHSGRWVTIDNSG-EVLVGSVG
DSQ  AACACGGCAATTCCCGCACAG------------GCGGGAGCTACTCCCTGGATGCAGACCGGCGCGGTGACCTCGCAGCCGATCGGGCATTACGAGTTCTGTCAGAAGTACAGGGGCGAGTGCAACGTCCGTTCGAAGGCTAAGGTGCCGCCGCGTGTCACCGCCGGCGGCTGGGCCGCCATTCGGCAGGTCAACGCCTCCGTCAACCGGCAGATCGCGCCGGTAACCGACATCGAGCTTACCGGCCGGGACGAGGTGTGGTCCTATCCGGGGAGA---CAGGGCGATTGCGAGGACTTCGCGCTCGAAAAGCGCAGACGCCTCATGCAGAAGGGCTTCTCCGCCGGCAACCTGCTGATGACTGTCGTGCGCAAGCCCGATGGCGAGGGCCATGCGGTGCTGACGGTCCGCACAGCTCAGGGCGACTTCATTCTCGACAATCTCGACGATGGGGTGAGGCTGTGGACGCACACGCCCTACCGCTTCCTCAAGCGCCAGGCGACGAACCACAGCGGCCGTTGGGTCACCATCGACAATAGCGGG---GAAGTGCTCGTCGGTTCCGTCGGA
TRN  10010101100011011
NAM  Q8UIP1_AGRT5/21-204
ASQ  AASAMAE----IKGSPSMVTGGITSQPIGHYEFCQKYADECNIRSKVTPPPRVTDYGWGVIREINTSVNTTIVAMTDQEIYGKDEVWEYPTTA-GDCEDFVLLKRKKLIERGFSVADLLITVVRKPDGEGHAVLTLRTTDGDYILDNLTDDVKLWTDTNYTYLKRQASFNTGRWISIEDGR-DVLVGALR
DSQ  GCTGCCTCCGCCATGGCGGAA------------ATCAAGGGAAGCCCTTCCATGGTAACGGGCGGGATCACGTCCCAGCCAATCGGCCATTACGAGTTCTGTCAGAAATACGCCGACGAGTGCAACATCCGCAGCAAGGTGACACCGCCGCCGCGCGTCACCGACTATGGCTGGGGCGTCATTCGCGAGATCAATACTTCCGTTAACACCACCATCGTGGCGATGACCGACCAGGAAATCTACGGCAAGGACGAGGTCTGGGAATATCCGACGACCGCC---GGCGACTGCGAAGATTTCGTGCTGCTGAAGCGCAAGAAGCTGATCGAGCGCGGGTTTTCCGTGGCCGATCTGCTGATCACCGTCGTCCGCAAGCCTGACGGAGAAGGCCATGCCGTGCTGACGCTTCGCACCACGGATGGAGATTATATTCTCGACAACCTCACCGACGACGTGAAGCTGTGGACCGACACCAACTACACCTATCTGAAGCGGCAGGCGTCCTTCAATACGGGCCGCTGGATTTCCATCGAAGATGGTCGC---GACGTTCTGGTCGGCGCGTTGCGC
TRN  11011101101011011
NAM  Q98ND9_RHILO/18-202
ASQ  SAWGSAYAA----GPAYMHTGGRTTQPVGHYEFCQRIPGECNEKTPKGAPVDLSRKLWATIVNINNSVNTRVKPRTDMENYGVEEYWAYPDNGYGDCEDYALEKRRELMDAGVPAGDLLMTVARQPNGDGHAVLTVRTSLGEFILDNLETKVLSWTDTDYTYLKRQSTENSGVWVTINDGR-SDAVASVR
DSQ  TCCGCTTGGGGATCAGCATATGCCGCG------------GGACCGGCCTATATGCATACGGGCGGCCGTACCACGCAGCCTGTCGGCCACTATGAATTCTGCCAGCGCATCCCTGGCGAATGCAACGAGAAGACGCCCAAGGGCGCGCCGGTCGACCTGAGCCGCAAGCTCTGGGCGACGATCGTCAACATCAACAATTCGGTCAACACCCGCGTTAAGCCGCGCACCGACATGGAAAACTACGGCGTCGAGGAGTACTGGGCCTATCCCGACAATGGCTATGGCGATTGCGAGGACTATGCGCTGGAGAAGCGCCGCGAACTGATGGACGCGGGCGTGCCGGCGGGCGATCTCCTGATGACGGTTGCGCGCCAGCCGAATGGCGACGGCCACGCCGTGCTGACAGTGCGCACCAGCCTCGGCGAGTTCATCCTCGACAATCTGGAAACCAAGGTGCTGTCCTGGACGGACACCGACTACACCTATCTCAAGCGTCAATCGACGGAGAATTCCGGCGTTTGGGTGACGATCAACGACGGCCGC---TCCGACGCGGTCGCCAGCGTCCGC
TRN  11011111101111101
NAM  Q8G056_BRUSU/14-201
ASQ  LGAGLAQAANPASTSPWMTTGERTSQPIGHYELCQRHPAECSSTSRSSASLKLTQRLWQQIIDVNERVNTTIAPMTDMEVWGQEEYWEYPTTA-GDCDDYMLLKRRELMALGVPANTLLFTVVRQPNGEGHAVLTVRTDRGDFILDNLDPRVLAWNKTDYTYLKRQSTYSTGSWVSIRDDR-DILVGSIH
DSQ  CTGGGTGCCGGGCTGGCGCAGGCCGCCAATCCCGCCTCGACCTCGCCCTGGATGACCACCGGCGAGCGCACCTCGCAACCGATAGGCCACTATGAACTCTGCCAGCGCCATCCAGCCGAATGCAGCAGCACAAGCCGCAGCAGCGCCTCGCTGAAACTGACGCAGCGGCTCTGGCAGCAGATCATCGACGTCAACGAGCGCGTAAACACGACGATCGCACCGATGACCGACATGGAAGTCTGGGGACAGGAAGAATATTGGGAATACCCGACCACGGCG---GGCGATTGCGACGACTATATGCTTCTCAAGCGCCGCGAACTGATGGCGCTGGGCGTACCGGCCAACACGCTTCTCTTCACCGTGGTTCGCCAGCCGAATGGTGAAGGCCACGCCGTTCTGACCGTTCGCACCGATCGCGGCGATTTCATTCTCGACAATCTCGACCCGCGTGTCCTCGCCTGGAACAAGACCGACTATACCTATCTCAAGCGCCAATCGACCTACAGCACGGGTAGCTGGGTTTCAATCCGGGATGACCGT---GACATTCTGGTCGGCAGCATTCAC
TRN  10010101100011001
NAM  Q8FXW4_BRUSU/23-206
ASQ  LAGFAAQAA----SGDFMQTGKITSQPIGHYEFCKREARECAITSRDTRALKLTPANWQHIIEVNFSVNERIKPMTDMEIYGIEEYWAYPTT-VGDCEDYVLLKQRELHQAGIPLTDLLITVVRKPNGEGHAVLTVRADRGDFVLDNLTDEVMRWDETDYTYLKRQAANHTGRWVTIEAPD-NLLVGSVR
DSQ  TTGGCAGGCTTTGCGGCGCAGGCTGCT------------TCCGGCGATTTCATGCAGACCGGCAAGATCACCTCGCAGCCGATCGGCCATTATGAATTCTGCAAGCGCGAAGCCAGGGAATGCGCCATCACCAGCCGCGACACCCGTGCGCTCAAACTCACCCCTGCCAACTGGCAGCACATTATCGAAGTGAACTTTTCGGTCAATGAACGCATCAAGCCGATGACCGACATGGAAATCTACGGCATCGAGGAATATTGGGCCTATCCGACCACG---GTTGGCGACTGCGAGGATTATGTCCTTCTCAAGCAGCGCGAACTGCATCAGGCAGGCATTCCGCTCACCGATCTCCTGATTACCGTTGTCCGCAAGCCGAATGGTGAAGGCCATGCCGTGCTGACGGTGCGCGCGGACCGTGGCGATTTCGTCCTCGACAACCTGACCGACGAAGTCATGCGCTGGGACGAAACCGACTATACCTATCTGAAGCGCCAGGCCGCCAACCATACGGGGCGTTGGGTCACAATCGAAGCCCCGGAC---AATCTTCTGGTCGGCTCGGTCCGC
TRN  10010101100011011
NAM  Q92QC1_RHIME/18-200
ASQ  LIAGPAYAV-----PANMTVGGATNPPIGHYEFCKANPSECAAIGADHGPSVLTRDSWKKILEVNYEVNQAIAPMTDMEIHGVEENWSYPDA-VGDCEDYVLLKRRRLIESGFSPADLLITVVLQPNGDGHAVLTVRTDRGDFILDNMRSKVLLWSDTEYTYLKRQSSEHAGRWVKLQDGR-ALAVGSVS
DSQ  CTCATCGCCGGGCCGGCTTACGCGGTG---------------CCGGCGAACATGACGGTCGGCGGCGCGACCAACCCGCCGATCGGGCATTACGAGTTCTGCAAGGCCAATCCCTCCGAATGCGCGGCCATTGGCGCGGACCATGGCCCGTCCGTGCTGACGCGCGACAGCTGGAAGAAGATCCTCGAAGTCAATTACGAGGTGAATCAGGCGATCGCCCCGATGACCGACATGGAAATCCATGGCGTCGAGGAAAACTGGTCCTACCCGGACGCC---GTCGGCGACTGCGAGGATTACGTGCTGCTGAAACGCCGCAGGCTGATCGAAAGCGGCTTCTCCCCCGCCGATCTTCTGATCACCGTCGTCCTGCAGCCGAATGGCGACGGTCATGCCGTCCTGACGGTGCGCACCGACCGCGGCGATTTCATTCTCGACAACATGCGCAGCAAGGTGCTGCTCTGGTCGGACACGGAATATACCTACCTGAAGCGGCAGTCCTCGGAGCATGCCGGGCGCTGGGTGAAACTGCAGGATGGCCGC---GCTCTCGCCGTCGGCAGCGTCAGC
TRN  10010101100011011
NAM  Q8UEK0_AGRT5/18-202
ASQ  AFAHQASAS----PAAVMRVIGKANPPIGHYEFCQTYQSECQPTSLDNGPLQLTEERWKTMLDVNYTVNTTITPMTDMEIYGVEERWAYPTT-VGDCEDFVLLKRKMLMNKGFSPSNLLITVVLQPNGEGHAVLTVRTDRGDFVLDNMRNKVMNWSETEYTYLKRQDTANPGRWVKIQDGRATAAVGGIR
DSQ  GCCTTCGCCCATCAGGCAAGCGCTTCG------------CCGGCCGCCGTCATGCGTGTGATCGGCAAGGCCAATCCGCCGATTGGTCACTATGAATTCTGCCAGACCTATCAGAGCGAATGCCAGCCGACCTCGCTGGACAATGGCCCGTTGCAGCTGACCGAAGAGCGCTGGAAGACGATGCTCGACGTCAACTACACCGTCAACACCACGATCACGCCGATGACCGACATGGAAATCTATGGCGTTGAAGAGCGCTGGGCCTATCCCACCACC---GTCGGCGATTGCGAAGATTTCGTGCTTCTGAAGCGCAAGATGCTGATGAACAAGGGCTTCTCTCCCTCCAACCTGCTGATCACCGTCGTTCTGCAGCCGAATGGCGAAGGCCACGCCGTTCTGACCGTCCGCACCGACCGTGGCGATTTCGTTCTCGACAACATGCGCAACAAGGTCATGAACTGGTCGGAAACCGAATACACCTACCTGAAGCGCCAGGACACGGCCAATCCGGGCCGCTGGGTGAAAATTCAGGACGGCCGCGCCACCGCGGCGGTCGGCGGCATCCGG
TRN  11011101101011011
NAM  Q8U7U2_AGRT5/16-199
ASQ  VVGLAAP----AQASPSMQTGRITSQPVGHYDFCQRHSAECQP-VKSMPPVSLTPDVWATLVSVNNAVNTEIDQRTDMEVWGYEDYWEYPYNGAGDCEDLALEKRKRLMDAGLPVSDLLITVVRDEKGDGHAILTVRTDRGDFILDNMKPKIFRWDETPYTYLKRQSTEHAGRWVDIEGTG-SPAIAARE
DSQ  GTCGTGGGTTTGGCCGCGCCG------------GCGCAGGCGTCTCCTTCGATGCAGACGGGCAGGATCACCTCACAGCCCGTCGGACATTACGACTTCTGCCAGCGGCATTCGGCTGAGTGCCAGCCG---GTGAAGTCCATGCCGCCGGTCAGTCTTACCCCTGATGTCTGGGCTACCCTCGTCTCGGTCAACAATGCCGTCAATACCGAGATCGACCAGCGGACCGACATGGAAGTGTGGGGTTACGAGGATTATTGGGAATATCCCTATAACGGCGCGGGAGACTGCGAGGACCTCGCGCTGGAGAAACGGAAGCGGCTGATGGACGCCGGTCTGCCGGTTTCCGACCTGCTGATCACCGTCGTCCGCGACGAAAAAGGTGATGGCCACGCCATCCTCACGGTCAGAACCGACCGCGGAGATTTCATTCTCGACAATATGAAGCCGAAGATTTTTCGCTGGGACGAAACGCCCTATACCTATCTCAAGCGTCAATCCACCGAGCATGCCGGTCGGTGGGTGGATATTGAAGGCACCGGT---TCGCCCGCCATCGCCGCCCGCGAG
TRN  10010101100011001
NAM  Q8FV24_BRUSU/2-184
ASQ  TLFGAAGIP-SAKAAQWSEAGGLTSIPYGHKEYCNRNPRNCGAH-RVLPPMKLTPQRMKLLQSVSSSVNHRIKPVSDQENYGKRDYWTMPVNGKGDCEDYVLMKRAQLMARGISPSQLLITMVQ--GSEAHVVLAVRTDRGDYILDNLRDEVLPVEKTSYRYIKMQSPANAGQWVSIAGR-SVAVANN--
DSQ  ACACTCTTCGGCGCGGCGGGCATACCT---TCGGCCAAGGCGGCGCAGTGGAGTGAAGCAGGCGGGCTGACAAGCATTCCTTACGGACATAAGGAATATTGCAACCGCAATCCGCGCAATTGCGGCGCACAC---CGCGTTTTGCCGCCCATGAAACTGACGCCGCAGCGCATGAAGCTGCTGCAATCGGTCAGTTCTTCGGTCAATCATCGCATCAAGCCGGTTTCCGATCAGGAGAATTACGGCAAGCGCGACTATTGGACCATGCCTGTCAACGGCAAGGGGGATTGCGAAGATTATGTTCTGATGAAGCGCGCGCAATTGATGGCGCGGGGTATCAGCCCGTCACAGCTTCTCATCACCATGGTACAA------GGCAGCGAGGCGCATGTCGTTTTGGCGGTGCGAACGGATCGGGGCGATTACATACTCGATAATCTGCGCGATGAGGTATTGCCGGTGGAAAAGACATCCTATCGCTATATCAAGATGCAGTCACCCGCCAATGCCGGGCAATGGGTCTCGATTGCAGGACGC---TCTGTGGCTGTTGCCAATAAT------
TRN  10010101100011001
//