EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05991 - DUF901)
FAM  PF05991
PID  DUF901
DES  Protein of unknown function (DUF901)
IPR  IPR010298
ANO  13
ALN  181
AID  0.369403
APH  ((YACP_BACSU/1-168:0.25236,Q9KGF1_BACHD/2-169:0.33927):0.07476,(Q8YAA9_LISMO/2-169:0.38965,((Q8F3Z2_LEPIN/44-209:2.13707,Q8CTT8_STAEP/3-171:0.38710):0.36976,((Q8E1Z1_STRA5/4-172:0.16981,Q8K5U0_STRP3/3-170:0.11595):0.67530,((Q8R7T6_THETN/2-167:0.63762,(Q8XHQ9_CLOPE/1-169:0.33972,Q97EG0_CLOAB/1-172:0.37675):0.21686):0.10210,(Q8YNL9_ANASP/7-182:0.79339,Q8GZ36_ARATH/130-301:0.98567):0.17346):0.19024):0.06862):0.18612):0.04675,Q8ETZ7_OCEIH/2-169:0.42515);
ATP  ((YACP_BACSU/1-168,Q9KGF1_BACHD/2-169),(Q8YAA9_LISMO/2-169,((Q8F3Z2_LEPIN/44-209,Q8CTT8_STAEP/3-171),((Q8E1Z1_STRA5/4-172,Q8K5U0_STRP3/3-170),((Q8R7T6_THETN/2-167,(Q8XHQ9_CLOPE/1-169,Q97EG0_CLOAB/1-172)),(Q8YNL9_ANASP/7-182,Q8GZ36_ARATH/130-301))))),Q8ETZ7_OCEIH/2-169);
ATL  9.44176
DNO  13
DLN  543
DID  0.466565
DPH  ((Q8XHQ9_CLOPE/1-169:0.28525,Q97EG0_CLOAB/1-172:0.26122):0.13653,((Q8GZ36_ARATH/130-301:0.57851,Q8YNL9_ANASP/7-182:0.52470):0.16633,(((Q8E1Z1_STRA5/4-172:0.21741,Q8K5U0_STRP3/3-170:0.20363):0.33726,Q8CTT8_STAEP/3-171:0.40035):0.12434,((Q8ETZ7_OCEIH/2-169:0.28345,Q8YAA9_LISMO/2-169:0.29038):0.05872,(YACP_BACSU/1-168:0.24450,Q9KGF1_BACHD/2-169:0.29087):0.09063):0.17542):0.07219):0.07956,(Q8F3Z2_LEPIN/44-209:1.10658,Q8R7T6_THETN/2-167:0.30606):0.21779);
DTP  ((Q8XHQ9_CLOPE/1-169,Q97EG0_CLOAB/1-172),((Q8GZ36_ARATH/130-301,Q8YNL9_ANASP/7-182),(((Q8E1Z1_STRA5/4-172,Q8K5U0_STRP3/3-170),Q8CTT8_STAEP/3-171),((Q8ETZ7_OCEIH/2-169,Q8YAA9_LISMO/2-169),(YACP_BACSU/1-168,Q9KGF1_BACHD/2-169)))),(Q8F3Z2_LEPIN/44-209,Q8R7T6_THETN/2-167));
DTL  6.45168
RID  0.369403
RPH  ((YACP_BACSU/1-168:0.25236,Q9KGF1_BACHD/2-169:0.33927):0.07476,(Q8YAA9_LISMO/2-169:0.38965,((Q8F3Z2_LEPIN/44-209:2.13707,Q8CTT8_STAEP/3-171:0.38710):0.36976,((Q8E1Z1_STRA5/4-172:0.16981,Q8K5U0_STRP3/3-170:0.11595):0.67530,((Q8R7T6_THETN/2-167:0.63762,(Q8XHQ9_CLOPE/1-169:0.33972,Q97EG0_CLOAB/1-172:0.37675):0.21686):0.10210,(Q8YNL9_ANASP/7-182:0.79339,Q8GZ36_ARATH/130-301:0.98567):0.17346):0.19024):0.06862):0.18612):0.04675,Q8ETZ7_OCEIH/2-169:0.42515);
RTP  ((YACP_BACSU/1-168,Q9KGF1_BACHD/2-169),(Q8YAA9_LISMO/2-169,((Q8F3Z2_LEPIN/44-209,Q8CTT8_STAEP/3-171),((Q8E1Z1_STRA5/4-172,Q8K5U0_STRP3/3-170),((Q8R7T6_THETN/2-167,(Q8XHQ9_CLOPE/1-169,Q97EG0_CLOAB/1-172)),(Q8YNL9_ANASP/7-182,Q8GZ36_ARATH/130-301))))),Q8ETZ7_OCEIH/2-169);
RTL  9.44176
LNK  Q8CTT8_STAEP/3-171:Q8CTT8:AE016744
LNK  Q8E1Z1_STRA5/4-172:Q8E1Z1:AE014201
LNK  Q8ETZ7_OCEIH/2-169:Q8ETZ7:BA000028
LNK  Q8F3Z2_LEPIN/44-209:Q8F3Z2:AE011396
LNK  Q8GZ36_ARATH/130-301:Q8GZ36:AK117231
LNK  Q8K5U0_STRP3/3-170:Q8K5U0:AE014168
LNK  Q8R7T6_THETN/2-167:Q8R7T6:AE013173
LNK  Q8XHQ9_CLOPE/1-169:Q8XHQ9:BA000016
LNK  Q8YAA9_LISMO/2-169:Q8YAA9:AL591974
LNK  Q8YNL9_ANASP/7-182:Q8YNL9:BA000019
LNK  Q97EG0_CLOAB/1-172:Q97EG0:AE007810
LNK  Q9KGF1_BACHD/2-169:Q9KGF1:BA000004
LNK  YACP_BACSU/1-168:P37574:D26185
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KGF1_BACHD/2-169
ASQ  REILIVDGYNMIGAWPELKEL-KDR-DLALARDKLIDRLAEYQAYTGCKVI-LVFDAHMVPG-VGRT-YNNHRIEVIYTRKNETADERIERLVRELKRID....-TQIYVATSDLAEQSHIFGSGALRKSARELYNEMEVTGKGIEKTVEKSNKEHNSTK---IALTEELAEIFEKWRRGD
DSQ  AGGGAGATTTTAATCGTTGACGGCTACAACATGATTGGTGCATGGCCTGAATTAAAGGAATTA---AAGGATCGC---GATTTGGCTCTCGCACGGGACAAGCTCATCGATCGGTTAGCCGAGTATCAAGCTTATACAGGTTGTAAGGTTATC---CTTGTTTTTGATGCTCATATGGTTCCTGGC---GTTGGGCGAACG---TATAACAATCACCGTATCGAAGTGATTTATACGAGAAAAAACGAGACGGCAGATGAGCGAATTGAAAGGCTCGTTCGGGAATTGAAACGGATTGAT............---ACCCAAATCTATGTAGCCACTTCTGACCTCGCAGAACAATCCCATATTTTTGGGAGTGGAGCCCTGCGAAAGTCAGCAAGAGAGCTTTATAATGAAATGGAAGTAACAGGAAAGGGGATTGAGAAAACTGTCGAAAAAAGCAATAAAGAACATAATTCGACAAAA---------ATTGCCCTTACCGAAGAATTGGCCGAAATTTTTGAAAAATGGCGTCGAGGCGAC
TRN  10010101100011000
NAM  YACP_BACSU/1-168
ASQ  MDILLVDGYNMIGAWPQLKDL-KAN-SFEEARDVLIQKMAEYQSYTGNRVI-VVFDAHLVKG-LEKK-QTNHRVEVIFTKENETADERIEKLAQALNNIA....-TQIHVATSDYTEQWAIFGQGALRKSARELLREVETIERRIERRVRKITSEKPAGK---IALSEEVLKTFEKWRRGD
DSQ  ATGGATATCCTGTTAGTAGACGGGTACAACATGATTGGAGCCTGGCCGCAGCTGAAGGATTTA---AAAGCGAAC---AGTTTTGAAGAGGCGAGAGACGTACTGATTCAGAAAATGGCGGAATATCAATCGTATACAGGAAACAGGGTTATT---GTTGTTTTTGACGCGCATCTCGTAAAAGGG---CTTGAGAAAAAA---CAGACCAACCATAGAGTTGAAGTAATTTTTACAAAAGAAAATGAGACGGCTGATGAGCGGATAGAAAAGCTCGCTCAGGCTTTGAATAATATTGCG............---ACTCAAATTCACGTTGCGACCTCTGACTATACTGAGCAGTGGGCGATTTTCGGACAGGGGGCATTGCGGAAATCGGCCCGGGAGCTTCTGAGAGAGGTAGAAACGATTGAAAGGCGAATAGAGAGACGGGTAAGAAAAATCACTTCCGAAAAGCCGGCGGGTAAA---------ATTGCTTTATCGGAAGAGGTTTTGAAAACGTTTGAAAAGTGGAGGCGGGGAGAC
TRN  10010101100011010
NAM  Q8YAA9_LISMO/2-169
ASQ  EQILLVDGYNVIGAWPELSYL-KDR-DLEAARDKLVEWMAEYQSYTGYRVV-VVFDAQFVRG-VKRK-SKKYQVEVVFTHEDETADEYIEQKAIEWKNVR....-TQIMVATSDYTEQWAIFGQGALRISSRELLFEIQEMSKQIGKKIKRIQEEMPKSN-L--NLDSDVISQLEKWRRGE
DSQ  GAACAAATTCTGCTTGTTGACGGGTATAATGTGATTGGGGCTTGGCCAGAATTAAGTTATTTG---AAAGATCGT---GATTTGGAAGCGGCGAGAGATAAGCTTGTTGAATGGATGGCGGAGTATCAGAGTTATACGGGATACCGGGTTGTG---GTCGTGTTTGATGCGCAGTTTGTCCGAGGT---GTGAAGCGGAAA---AGCAAGAAATATCAAGTCGAAGTAGTTTTTACACATGAGGATGAAACGGCGGATGAATATATTGAACAAAAAGCAATTGAATGGAAAAATGTGCGG............---ACGCAAATTATGGTAGCGACATCTGACTATACAGAACAGTGGGCTATTTTTGGACAAGGAGCGTTACGGATTTCTTCGCGAGAACTACTTTTTGAAATTCAAGAAATGAGCAAACAAATCGGTAAGAAAATCAAGCGAATTCAGGAAGAAATGCCAAAATCCAAC---CTT------AATCTAGATTCTGATGTTATTTCGCAGCTTGAAAAGTGGAGAAGAGGCGAG
TRN  10010101100011010
NAM  Q8ETZ7_OCEIH/2-169
ASQ  KEVLIVDGYNVIGAWGELQRL-KEK-EIGQARDRLIEVLAEYQAFTGKHVI-LVFDAYYVRG-VENK-QQKFNIEIIYTKEKETADECIEKLVKEVKNIQ....-TQVYVATSDYAEQRTIFGQGALRKSARELLIEVQDMDREIHVSLEVHRKTKPQAK-I--KIDKEIMEKFEQMRRGE
DSQ  AAAGAAGTCTTGATTGTTGATGGATATAATGTAATTGGAGCTTGGGGAGAATTGCAACGATTG---AAAGAGAAA---GAAATTGGACAGGCAAGAGATCGACTCATCGAAGTGTTAGCGGAATATCAAGCCTTTACTGGAAAGCATGTTATT---CTCGTCTTTGATGCTTATTATGTACGTGGT---GTAGAAAATAAA---CAACAAAAATTTAACATTGAGATTATTTATACCAAAGAAAAAGAGACAGCGGACGAATGTATCGAAAAACTAGTTAAAGAAGTGAAAAACATCCAA............---ACTCAAGTTTATGTAGCAACTTCGGATTATGCTGAACAACGAACTATTTTCGGACAAGGCGCACTACGCAAATCCGCACGAGAGTTACTTATTGAAGTGCAGGATATGGATAGAGAGATTCATGTTAGTTTAGAAGTTCATCGAAAAACAAAACCGCAAGCTAAA---ATA------AAAATTGATAAAGAAATCATGGAAAAGTTTGAACAAATGCGAAGAGGAGAA
TRN  10010101110011010
NAM  Q8CTT8_STAEP/3-171
ASQ  KRYLIIDGYNMIGQSSTLSTV-AKE-NLEEAREQLLDTIANYNALIADEIV-CVFDAYEQSG-IERE-YFYHGVKTIFTKEKETADSFIERYVYELYNKH....TTHITVVTSDMSEQHAIFGSGAYRISSREMWRELKENEVVVNKSLDDFSEKKPRIR---IPLSNEILEEFEKIRRGN
DSQ  AAAAGATACTTAATTATAGATGGTTACAATATGATTGGCCAATCCTCAACACTTAGCACTGTT---GCTAAAGAG---AATTTAGAAGAAGCTAGAGAGCAATTATTAGACACAATTGCCAACTACAATGCATTAATAGCAGATGAAATTGTC---TGTGTATTTGATGCCTATGAACAGTCAGGG---ATAGAAAGGGAA---TACTTCTATCATGGTGTCAAAACAATCTTTACTAAAGAAAAAGAAACTGCAGATAGTTTTATAGAACGCTACGTGTATGAATTATATAATAAACAC............ACGACACACATTACCGTTGTAACAAGTGATATGAGTGAACAACATGCTATTTTTGGTTCAGGTGCATATCGTATTTCTTCAAGAGAAATGTGGCGTGAATTAAAAGAAAATGAGGTTGTTGTTAACAAGTCACTTGATGATTTTAGCGAAAAGAAACCAAGAATTAGA---------ATTCCGTTATCTAATGAGATACTTGAAGAATTTGAAAAGATTAGACGTGGCAAT
TRN  10010101110011000
NAM  Q8K5U0_STRP3/3-170
ASQ  KRILLVDGYNMIAFWQSTRQLFKTN-QLDQARNTLLTKLNHYAHFENINII-CVFDAQYVPG-LRQR-YDQYYISVVFTEEDETADSYIERMAAELN-TA....IHMVEVATSDLNEQWTIFSQGALRVTARELEQRVHTVKADLDKMSRDIDLKTPKLR----PFDQGQLSQLKDFMSQL
DSQ  AAACGGATATTATTAGTAGATGGGTATAATATGATTGCCTTTTGGCAATCAACCCGTCAGTTGTTTAAGACAAAT---CAGCTTGATCAGGCACGTAACACACTTTTAACAAAACTTAATCATTATGCCCATTTTGAGAATATTAATATTATT---TGTGTTTTTGATGCCCAATATGTACCGGGG---CTAAGGCAACGA---TATGACCAGTATTATATCTCAGTGGTATTTACAGAGGAAGACGAAACAGCAGATAGCTACATTGAGCGCATGGCAGCAGAGTTAAAT---ACGGCT............ATACATATGGTAGAAGTAGCTACGAGTGATTTAAATGAACAATGGACGATTTTTTCTCAAGGAGCTCTTCGTGTCACTGCAAGAGAATTAGAGCAAAGAGTTCATACTGTCAAAGCTGATTTAGATAAAATGTCTAGAGATATTGATCTCAAAACGCCTAAACTGCGG------------CCTTTTGACCAAGGACAGCTTAGTCAATTGAAGGATTTTATGTCTCAGTTA
TRN  10010101100011000
NAM  Q8E1Z1_STRA5/4-172
ASQ  HSILLVDGYNMIAFWKDTRQLFKSN-RLEEAREVLLRKLNHYAHFEHIDII-CVFDAQYVPG-VRQR-YDQYKISVIFTEEDETADSYIERAAAELNQSV....LNLVSVATSDLNEQWTIFSQGALRVSARELEQRVATVKSDLDKMSSQIDLSTPKLR----PWNDEQLGKLKDFLDGM
DSQ  CATTCTATCTTACTCGTTGATGGCTACAATATGATTGCTTTTTGGAAAGATACTCGACAGCTTTTTAAAAGCAAT---CGTTTAGAAGAGGCAAGGGAAGTATTACTTAGAAAGCTAAATCATTACGCACATTTCGAACACATTGATATTATT---TGTGTATTTGATGCACAGTATGTTCCTGGT---GTACGTCAACGT---TATGACCAATACAAAATATCCGTTATCTTTACTGAGGAGGACGAAACTGCGGATAGCTATATTGAACGAGCAGCGGCAGAACTTAATCAATCTGTG............TTAAATTTAGTCTCCGTTGCTACCAGTGATTTAAATGAACAATGGACTATATTTTCTCAGGGTGCTTTACGTGTCTCGGCTAGAGAATTGGAACAGCGTGTAGCGACAGTAAAATCAGATTTGGATAAGATGTCCAGTCAAATCGATTTGAGTACGCCAAAGTTAAGG------------CCGTGGAATGATGAACAACTAGGAAAACTCAAGGATTTTTTAGATGGTATG
TRN  10010101110011000
NAM  Q97EG0_CLOAB/1-172
ASQ  MKTILVDGYNVINSWGKLNSI-KDDVSLESARDKLIEVLVEYGEFTNCKII-VVFDAHHIPGNTGEKIKMYDKFTIVYTKAGETADSFIERYVNKVGRK-....-SEVCVVTSDNLEQQVVFQRGSTRMSSIEFYNDVQKIHGRISKKAEKIRNEKKYNR-LEDRIDKNIMEKLDKIRKNL
DSQ  TTGAAAACTATTCTTGTGGATGGGTACAATGTTATAAATAGTTGGGGAAAACTCAATTCTATT---AAGGATGATGTGAGTTTAGAGAGTGCAAGAGATAAGCTTATAGAGGTATTAGTAGAATACGGCGAATTTACGAATTGCAAGATTATA---GTTGTTTTTGATGCGCATCATATCCCTGGGAACACTGGAGAAAAGATTAAAATGTACGATAAATTTACTATAGTGTATACAAAGGCAGGAGAAACAGCAGATAGTTTTATTGAAAGATATGTAAATAAAGTTGGAAGAAAA---............---TCTGAAGTTTGTGTAGTTACATCCGATAATTTAGAACAGCAGGTTGTTTTTCAAAGAGGATCTACTAGAATGTCTTCCATAGAATTTTATAATGATGTACAAAAAATTCATGGGAGAATAAGCAAAAAAGCTGAGAAAATTAGAAATGAAAAGAAGTATAATCGG---TTAGAAGATAGAATTGATAAAAATATAATGGAAAAACTGGATAAAATAAGAAAAAATCTT
TRN  10010101100011010
NAM  Q8XHQ9_CLOPE/1-169
ASQ  MRVIFIDGYNVINSWPNLKKS-KNY-SYDIARTELTEMLENYAAFNSCKIY-LVFDAHKVAGNIESK-ELSGNIITVFTKEGEIADAYIERMVDELGRK-....-VEIVVVTSDRLEQQTIFQRGAVRMSSIEFYNEVLKVQDNIRKKAEKNKLELGKN-FLGDTLEESVLEKLEKMRRG-
DSQ  ATGAGAGTTATATTTATAGATGGTTATAATGTTATAAATAGTTGGCCTAATCTAAAAAAGTCA---AAAAATTAT---AGCTATGATATAGCAAGAACAGAGCTTACAGAAATGCTTGAAAATTATGCTGCTTTTAACTCTTGTAAAATTTAT---TTAGTTTTTGATGCTCATAAGGTTGCTGGAAATATTGAAAGCAAA---GAGTTATCTGGAAATATAATTACTGTCTTTACAAAAGAAGGCGAAATTGCTGATGCATATATTGAGAGAATGGTAGATGAACTAGGAAGAAAA---............---GTAGAAATTGTTGTTGTAACCTCGGATAGGTTAGAACAACAAACTATTTTCCAAAGAGGGGCCGTGAGAATGTCATCTATTGAATTCTACAATGAAGTGTTAAAAGTTCAGGATAACATTAGAAAAAAGGCAGAAAAAAATAAATTAGAATTAGGTAAAAAT---TTTTTAGGCGATACTTTAGAAGAAAGTGTATTAGAAAAATTAGAAAAAATGAGAAGAGGG---
TRN  10010101110011000
NAM  Q8R7T6_THETN/2-167
ASQ  PLYMLVDGYNVINNWQMLKEI-AKR-SLEDARDKLIDLLADFKGYTGINII-LVFDAMYVKGSLEKH-EEINGIEVVYTKEGESADHFIESKVVELVKK-....-EDVVVVSSDWIVQQVVMAHGAIRMSARELYEEMNRYIEKHKKEYMNTFYKDN----LENRLDEETVKKLRQMREN-
DSQ  CCCTTGTATATGCTGGTAGACGGTTATAATGTCATAAACAACTGGCAGATGCTCAAGGAAATT---GCAAAGAGA---AGTCTGGAAGATGCGAGAGACAAATTAATAGATTTGCTGGCAGATTTTAAAGGATATACAGGCATAAATATAATA---TTGGTTTTCGATGCCATGTATGTAAAAGGGAGTTTGGAAAAGCAT---GAAGAGATAAATGGCATTGAAGTAGTGTACACAAAAGAAGGAGAATCGGCAGACCATTTTATAGAGTCGAAAGTGGTAGAGCTCGTCAAAAAA---............---GAGGATGTGGTAGTGGTAAGCTCAGACTGGATTGTGCAGCAGGTAGTCATGGCTCACGGTGCCATTAGGATGTCAGCTAGGGAACTTTACGAGGAGATGAACAGGTACATTGAAAAGCACAAAAAGGAGTATATGAATACTTTTTACAAGGACAAT------------CTGGAAAATAGGTTAGATGAGGAAACTGTAAAGAAGCTTCGTCAAATGAGGGAAAAC---
TRN  10010101100011000
NAM  Q8YNL9_ANASP/7-182
ASQ  PAVLLVDGYNIIGAWPCLKKT-RDKNGLEAARGQLVEAMTSYSSFQGYDTQ-IVFDAHYQNT-CSNKEIITELVSVYYTDFGQTADTYIEKICASLRPEVsqarISRVIVATSDRAQQLTVQGYGAEWLSAYQLCGEVETTVCRMRQKYQSRKQS--KSRFLASAIDPKARQKLAELRMGI
DSQ  CCAGCCGTTTTATTAGTAGACGGCTACAATATAATTGGCGCTTGGCCGTGTTTGAAAAAAACC---CGTGATAAAAATGGGCTAGAAGCTGCTCGCGGGCAACTTGTGGAAGCGATGACAAGTTACAGCTCGTTTCAGGGTTATGATACTCAA---ATAGTTTTTGATGCTCACTATCAAAATACT---TGTAGTAACAAAGAAATTATTACAGAGCTAGTTTCAGTTTATTACACAGATTTTGGGCAAACAGCAGATACCTATATTGAAAAAATTTGTGCTTCTTTGCGCCCCGAAGTTtcacaagctcggATTTCTCGTGTAATTGTTGCTACATCAGACCGCGCACAACAGTTGACAGTACAGGGATATGGGGCTGAATGGTTATCAGCATATCAACTGTGCGGGGAGGTAGAAACTACAGTGTGTAGGATGCGACAAAAGTATCAATCTCGTAAACAATCT------AAAAGTAGGTTTCTCGCTAGCGCTATTGATCCTAAAGCGCGTCAAAAGCTAGCTGAACTACGAATGGGTATT
TRN  10010101100011000
NAM  Q8GZ36_ARATH/130-301
ASQ  VPVLLVDGYNVCGYWMKLKKHFMK-GRLDVARQKLVDELVSFSMVKEVKVV-VVFDALMSGL-PTHK-EDFAGVDVIFSGET-CADAWIEKEVVALREDG....CPKVWVVTSDVCQQQAAHGAGAYIWSSKALVSEIKSMHKEVEKMMQETRSTSFQGRLLKHNLDSEVVDALKDLRDKL
DSQ  GTTCCGGTTTTGCTTGTTGATGGTTATAATGTGTGTGGATATTGGATGAAGTTAAAGAAACATTTCATGAAA---GGAAGGCTTGACGTTGCTCGGCAGAAGTTAGTTGATGAACTTGTGTCCTTCAGTATGGTTAAAGAGGTTAAGGTAGTG---GTTGTGTTTGATGCTCTCATGTCTGGTCTT---CCTACTCACAAG---GAAGACTTTGCAGGTGTTGATGTGATTTTCTCAGGAGAAACT---TGTGCTGACGCTTGGATTGAAAAGGAGGTGGTTGCATTGAGAGAAGATGGA............TGCCCCAAGGTTTGGGTTGTAACATCTGATGTCTGTCAACAACAAGCAGCACATGGAGCGGGAGCTTATATTTGGAGTAGCAAGGCATTGGTTTCTGAGATTAAATCGATGCATAAGGAGGTTGAGAAAATGATGCAAGAAACAAGGTCAACATCTTTCCAAGGGAGATTGCTTAAACACAATCTTGATTCTGAAGTCGTTGATGCTCTTAAAGATCTTAGAGACAAATTA
TRN  10010101110011000
NAM  Q8F3Z2_LEPIN/44-209
ASQ  LFQVAIDGFNLIYKFPDLEESMYQN-RLSDARRTLLEWIELYSKKKKKQNFHIFFDGKKEIG-NEVL-QETFGKLNVYYSRDRKADDLIKEFVRTQIRP-....-ADVQVVSSDKEIFYHAKKWGAHPITSEEF-ASIVTAEIFPSKQKTDLEELKD-----KKLSSEELEYWKNLFRKGK
DSQ  TTATTTCAAGTGGCGATTGACGGTTTTAATCTGATCTATAAATTTCCAGATTTGGAAGAATCCATGTATCAAAAT---CGGCTTTCTGACGCCAGGCGAACCCTTTTGGAATGGATCGAGTTGTATTCCAAAAAAAAGAAAAAACAAAACTTTCACATTTTTTTTGATGGAAAGAAAGAAATAGGA---AACGAAGTTCTC---CAAGAAACATTCGGGAAATTGAACGTATATTATAGCCGAGATAGAAAAGCGGACGACTTGATTAAGGAGTTTGTTCGAACTCAAATTCGTCCG---............---GCGGATGTTCAAGTAGTCAGTTCGGATAAGGAAATTTTTTATCACGCAAAAAAATGGGGCGCTCATCCAATTACCTCGGAAGAATTT---GCGTCTATCGTTACTGCGGAGATTTTCCCTTCTAAACAGAAAACCGATCTAGAAGAACTCAAAGAT---------------AAAAAGTTGAGTTCCGAAGAATTGGAATATTGGAAAAATTTATTTAGGAAGGGTAAA
TRN  10010101100011010
//