EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05982 - DUF897)
FAM  PF05982
PID  DUF897
DES  Domain of unknown function (DUF897)
IPR  IPR010293
ANO  7
ALN  411
AID  0.338407
APH  (Q9K663_BACHD/12-337:0.59094,Q8YY66_ANASP/13-322:0.51040,((((Q8YV47_ANASP/18-370:0.04197,P73953_SYNY3/18-374:0.14422):1.12325,Q9A2P7_CAUCR/49-365:0.65779):0.09252,P71757_MYCTU/16-407:0.64850):0.10287,Q8EAY3_SHEON/4-319:0.92020):0.05378);
ATP  (Q9K663_BACHD/12-337,Q8YY66_ANASP/13-322,((((Q8YV47_ANASP/18-370,P73953_SYNY3/18-374),Q9A2P7_CAUCR/49-365),P71757_MYCTU/16-407),Q8EAY3_SHEON/4-319));
ATL  4.8721
DNO  7
DLN  1233
DID  0.447727
DPH  ((((Q9K663_BACHD/12-337:0.53410,Q8YY66_ANASP/13-322:0.39169):0.08728,Q8EAY3_SHEON/4-319:0.57836):0.08586,(P73953_SYNY3/18-374:0.16489,Q8YV47_ANASP/18-370:0.13515):0.57215):0.14520,P71757_MYCTU/16-407:0.37685,Q9A2P7_CAUCR/49-365:0.45167);
DTP  ((((Q9K663_BACHD/12-337,Q8YY66_ANASP/13-322),Q8EAY3_SHEON/4-319),(P73953_SYNY3/18-374,Q8YV47_ANASP/18-370)),P71757_MYCTU/16-407,Q9A2P7_CAUCR/49-365);
DTL  3.5232
RID  0.338407
RPH  (Q9K663_BACHD/12-337:0.59094,Q8YY66_ANASP/13-322:0.51040,((((Q8YV47_ANASP/18-370:0.04197,P73953_SYNY3/18-374:0.14422):1.12325,Q9A2P7_CAUCR/49-365:0.65779):0.09252,P71757_MYCTU/16-407:0.64850):0.10287,Q8EAY3_SHEON/4-319:0.92020):0.05378);
RTP  (Q9K663_BACHD/12-337,Q8YY66_ANASP/13-322,((((Q8YV47_ANASP/18-370,P73953_SYNY3/18-374),Q9A2P7_CAUCR/49-365),P71757_MYCTU/16-407),Q8EAY3_SHEON/4-319));
RTL  4.8721
LNK  P71757_MYCTU/16-407:P71757:BX842579
LNK  P73953_SYNY3/18-374:P73953:BA000022
LNK  Q8EAY3_SHEON/4-319:Q8EAY3:AE015809
LNK  Q8YV47_ANASP/18-370:Q8YV47:BA000019
LNK  Q8YY66_ANASP/13-322:Q8YY66:BA000019
LNK  Q9A2P7_CAUCR/49-365:Q9A2P7:AE006009
LNK  Q9K663_BACHD/12-337:Q9K663:BA000004
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9A2P7_CAUCR/49-365
ASQ  PAVLFFALGLIAAMARSDLALPRDAAKTLSLILMLCIGFKGGVEARA---HGLDAGFLKAAGLGLALSFLLPLPAYALLRR-TGLDTLTAAATAAHYGSVSVVTFAAAQSYLSSIGQAPGGYMSAVLALMETPGLLTAIAI----------------------------------------------------------AALTTRGVA----TGQDADRAS---------------AGKLAHEVLLNAASVVLIGGFLIGLITGEAGGERLK---TFTGPVFQGVLCVFLLDLGVRAGRQLAAARGMNLGVLALGIVLPILGGVVALTLG-------WMA--GLPAGDLAALAVLAASASYIAAPAAMSMALPKADAGVYLTLSLGVTFPFNLTIGIPLLAIAAARLAG-G
DSQ  CCGGCGGTGCTGTTCTTCGCCCTGGGGCTGATCGCCGCCATGGCGCGCTCGGACCTCGCCTTGCCGCGCGATGCGGCCAAGACCCTGTCGCTGATCCTGATGCTGTGTATCGGCTTCAAGGGCGGGGTCGAGGCGCGCGCC---------CACGGGCTGGACGCGGGTTTCCTGAAGGCGGCGGGCCTGGGCTTGGCGCTGAGCTTCCTGCTGCCGCTGCCGGCCTACGCGCTTCTGCGCCGC---ACGGGTCTGGACACGCTGACCGCCGCCGCCACCGCCGCCCATTACGGATCGGTGTCGGTGGTGACCTTCGCCGCGGCCCAGAGCTATCTGTCGTCGATCGGCCAGGCTCCTGGCGGCTACATGTCGGCCGTGCTGGCCTTGATGGAGACGCCCGGCCTGCTGACCGCAATCGCCATC------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GCCGCCTTGACGACCCGCGGCGTCGCG------------ACCGGCCAGGACGCCGACCGCGCCTCG---------------------------------------------GCGGGCAAGCTCGCCCATGAGGTGCTGCTGAACGCGGCCAGTGTGGTGCTGATCGGCGGCTTCCTGATCGGCCTGATCACCGGTGAGGCGGGGGGCGAGCGTCTGAAG---------ACCTTCACCGGTCCCGTGTTCCAGGGCGTGCTCTGCGTCTTCCTGCTGGACCTGGGCGTGCGCGCCGGGCGGCAACTGGCTGCTGCGCGCGGCATGAACCTGGGCGTTCTGGCCTTGGGGATCGTGCTGCCGATCCTGGGCGGCGTGGTCGCCCTGACCTTGGGC---------------------TGGATGGCG------GGTCTGCCGGCCGGCGACCTCGCCGCCCTGGCGGTTCTGGCGGCCTCGGCCTCCTATATCGCCGCGCCGGCGGCCATGAGCATGGCCCTGCCCAAGGCCGACGCCGGTGTCTATCTGACCCTGTCCCTGGGCGTGACCTTCCCGTTCAACCTGACGATCGGCATCCCGCTGCTGGCCATTGCGGCGGCGCGACTGGCGGGA---GGG
TRN  11011111101111111
NAM  Q9K663_BACHD/12-337
ASQ  PVVLFFLLGIIAATFKSDLQFPKGLTEALSMYLLIAIGIKGGIELSH---YHLEA-VIGPVIGTIFLGMLIPVIVLMITRLFMKVDLKNSIALAATYGSTSIVTYGAAVSFLEKSGTTYEGFMNAMVVLKESPAILVSLLL----------------------------------------------------------LSIIERQQA----VPTTLSSKRVGIVSGHQGLI----DKEVLKESFFGKSIILLLGSLIIGLVVGERAIPMVQ---PLFIDLYQSVLILFLLYMGLTVGERLPEVKKHGIKLILFGVLTPILLGALGVLVG-------TLA--GLSVGGATLMGILAGSASYIAAPAALRTSVPEANPSIYLGLSLGVTFPFNLIFGIPLY-FEFAKLL--H
DSQ  CCTGTAGTCTTGTTTTTTCTATTAGGTATTATTGCTGCGACCTTTAAATCTGATTTGCAGTTTCCAAAAGGATTGACAGAAGCGTTAAGTATGTACCTTTTGATTGCGATCGGAATAAAGGGAGGGATTGAACTTTCACAC---------TATCATCTCGAGGCG---GTAATTGGGCCAGTTATTGGGACGATATTTTTAGGCATGTTGATCCCGGTTATCGTTCTTATGATTACACGCTTGTTTATGAAAGTGGACTTAAAGAACTCAATTGCGCTTGCTGCCACTTATGGATCGACGAGTATAGTAACTTATGGTGCGGCTGTATCGTTTCTTGAGAAAAGTGGCACGACCTATGAAGGATTTATGAATGCGATGGTTGTGTTAAAGGAAAGTCCTGCAATTTTAGTATCCTTATTGTTA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTAAGCATCATTGAAAGGCAACAGGCT------------GTTCCAACAACTTTATCTTCTAAACGAGTGGGGATTGTCTCAGGGCATCAGGGACTGATT------------GATAAAGAAGTACTGAAGGAAAGCTTTTTTGGAAAAAGCATTATATTACTTCTAGGAAGCCTAATTATTGGCCTTGTAGTAGGTGAACGAGCGATTCCGATGGTTCAA---------CCTCTTTTTATCGACTTGTATCAAAGCGTTCTGATTCTTTTCCTTTTGTATATGGGGTTAACCGTTGGCGAACGTTTACCTGAAGTTAAAAAGCACGGAATCAAACTCATCCTGTTCGGTGTACTGACCCCGATTTTGCTTGGGGCGTTGGGTGTTCTCGTAGGA---------------------ACACTTGCC------GGTTTATCAGTTGGGGGAGCAACATTGATGGGGATTTTAGCAGGGAGCGCCTCCTATATTGCGGCTCCTGCTGCATTGCGAACGTCTGTACCAGAGGCAAATCCATCGATTTATTTAGGGCTATCACTAGGGGTCACTTTCCCGTTCAATCTTATCTTCGGTATTCCTCTATAT---TTTGAATTTGCGAAGTTGCTC------CAT
TRN  10010101100011000
NAM  Q8YY66_ANASP/13-322
ASQ  PPVLFFFLGMLAVFVKSDLEIPAPIPKALSLYLLFAIGFKGGVELIK---SGVTQEVVFTLLAAMLMACFVPIYTFFILK--LKLDTYDAAAIAATYGSISAVTFITASTFLSELGIAFDGYMVAALALMESPAIIVGLIL------------------------------------------------------------------------------VNLFTVDEKREFA----WSEVLQEAFLNSSVFLLVGSLFIGFLTGEHGWQVLE---PFTQGLFYGALTFFLLDMGLVAARRIKDLQKTGFFLILFAILIPILNAGIGLLIA-------KFI--GMPAGDSLLFAVLSASASYIAVPAAMRLTVPEANPSLYVSTALAVTFPFNIIVGIPLY-QYGINLFW-R
DSQ  CCGCCAGTACTCTTTTTCTTTCTGGGAATGCTTGCTGTTTTTGTCAAGTCGGATCTGGAAATTCCTGCGCCTATACCTAAAGCCTTATCGCTTTATTTGCTATTCGCCATAGGTTTTAAAGGAGGAGTAGAACTAATTAAA---------AGTGGGGTGACTCAGGAAGTGGTCTTCACGCTTCTGGCGGCGATGTTAATGGCCTGCTTTGTTCCCATTTACACGTTCTTTATTTTAAAA------CTGAAACTGGATACTTACGATGCGGCGGCGATCGCTGCCACTTACGGATCTATAAGTGCTGTTACCTTCATCACCGCCAGCACCTTTTTAAGTGAGTTGGGGATTGCTTTTGATGGTTACATGGTCGCAGCCCTCGCCCTGATGGAATCTCCAGCCATTATTGTTGGTCTGATCTTG------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GTCAATCTCTTCACCGTTGATGAAAAGCGAGAATTTGCC------------TGGTCAGAGGTTTTACAAGAAGCATTTTTGAATAGTTCCGTCTTTTTGTTAGTTGGTAGCCTCTTCATTGGCTTCTTAACAGGAGAACATGGTTGGCAAGTCTTAGAA---------CCCTTTACACAAGGGCTATTTTACGGCGCTCTCACCTTCTTTCTCTTAGATATGGGATTAGTGGCAGCCAGAAGAATTAAAGACTTGCAAAAAACAGGATTTTTCCTGATTTTATTTGCCATACTAATTCCAATACTCAATGCAGGCATTGGCTTACTAATTGCC---------------------AAATTCATT------GGTATGCCGGCGGGCGATTCTCTATTATTTGCTGTGTTGTCCGCTAGTGCTTCTTACATCGCCGTCCCAGCAGCTATGCGGTTAACTGTTCCAGAAGCCAACCCCAGTCTGTATGTTTCTACCGCTTTGGCCGTGACATTTCCGTTCAACATTATTGTGGGCATCCCATTATAC---CAATACGGAATTAACCTATTTTGG---AGG
TRN  10010101100011000
NAM  P71757_MYCTU/16-407
ASQ  PLLLFFYFGFLIPIFKVRFEFPYVLYQGLTLYLLLAIGWHGGEELAKIKPSNVGA-IVGFMVVGFALNFVIGTLAYFLLSKLTAMRRVDRATVAGYYGSDSAGTFATCVAVLTSVGMAFDAYMPVMLAVMEIPGCLVALYL-VARLRHRGMNEAGYMADEPGYTTAAMIGAGPGTPARPAHSDSLTAQAERGIEEELE-LSLEKREHPNWDEDGVKDSGTN-------ASIF----SRELLQEVFLNPGLVLLFGGIVIGLISGLQGQKVLHDDDNFFVAAFQGVLCLFLLEMGMTASRKLKDLASAGSGFVFFGLLAPNLFATLGIIVA---HGYAYVTNNDFAPGTYVLFAVLCGAASYIAVPAVQRLAIPEASPTLPLAASLGLTFSYNVTIGIPLY-IEIARIVG-Q
DSQ  CCGCTGCTGCTGTTCTTCTATTTCGGGTTCTTGATCCCGATCTTCAAGGTGCGATTCGAGTTCCCCTATGTGCTCTACCAGGGCCTAACCCTGTATCTGCTGCTGGCCATCGGTTGGCACGGCGGCGAAGAACTCGCCAAGATCAAGCCGTCCAACGTCGGCGCC---ATCGTTGGGTTCATGGTGGTTGGCTTCGCCTTGAACTTCGTGATCGGCACCTTGGCATACTTCCTGCTGAGCAAGCTGACCGCCATGCGCCGGGTCGACAGGGCGACGGTCGCCGGCTATTACGGGTCGGACTCGGCAGGGACATTTGCCACCTGTGTAGCAGTCCTGACCAGCGTCGGCATGGCCTTCGACGCCTACATGCCGGTCATGTTGGCCGTCATGGAGATCCCCGGCTGCCTGGTGGCGCTGTATCTG---GTGGCGCGGCTGCGGCACCGAGGGATGAACGAGGCGGGGTACATGGCCGACGAGCCCGGCTACACCACAGCGGCGATGATCGGAGCGGGGCCCGGCACGCCCGCCCGGCCCGCTCACAGCGACAGCCTCACGGCCCAAGCCGAGCGCGGCATCGAAGAAGAGTTGGAG---CTCTCGCTGGAAAAGCGCGAGCATCCAAATTGGGATGAAGACGGCGTCAAAGACAGCGGCACGAAT---------------------GCGTCGATCTTC------------TCACGCGAGTTGCTGCAGGAAGTTTTCCTCAACCCGGGGCTCGTTCTCCTCTTCGGCGGCATCGTCATCGGCCTGATCAGTGGACTGCAGGGACAGAAGGTCCTACACGACGACGACAACTTCTTTGTGGCGGCATTCCAGGGCGTACTTTGCCTGTTCCTGTTGGAGATGGGCATGACGGCGTCGCGTAAGTTGAAGGATCTGGCGTCGGCGGGCAGTGGGTTCGTTTTCTTCGGCCTGCTGGCACCGAATCTGTTTGCGACGCTTGGGATCATCGTGGCC---------CACGGCTACGCATACGTCACTAACAACGACTTCGCGCCGGGCACATATGTGCTGTTCGCGGTGCTCTGCGGCGCGGCGTCCTATATCGCCGTCCCGGCCGTGCAACGGCTTGCGATCCCCGAGGCCAGTCCGACCTTGCCGCTGGCCGCGTCGCTGGGTTTGACGTTCTCCTACAACGTCACGATCGGGATCCCGCTGTAC---ATCGAGATCGCCCGCATCGTCGGG---CAA
TRN  10010101100011001
NAM  Q8EAY3_SHEON/4-319
ASQ  IVIAFFALGLLAGLVKSDLKVPPAIYETLSILLMLTLGLKGGMALHG---HTQNL-VFTELVAVVALGLLIPLALYPVLTRLVRLGRTDAISIAAHYGSVSAGTFAVVIAMVEKSGMTLRPETTLYLVLLELPAIVVMLWL----------------------------------------------------------HRYLSAKQP----LQATVPNTQ---------------QSSILHEALTSRGVVLLVGGVVIGWLYGPTGLAAIS---PVLLGGFKTLLALFLLEMGLVTAKVCLPLPLQQWRLLVFAAVTPFALAWCGIGVG-------LWL--ELPPGSILVLAGLSASASYIAAPAAIRAAIPEANIGLAMLASLGITFPVNVLIGLPLYQHWVMQIT--G
DSQ  ATTGTCATTGCATTTTTCGCCTTAGGTTTGCTCGCAGGCTTAGTCAAATCCGACCTTAAAGTGCCACCCGCTATTTATGAAACCCTGTCGATTTTGTTAATGCTTACCTTAGGGTTAAAGGGCGGCATGGCACTGCACGGC---------CATACTCAAAACCTA---GTGTTCACTGAACTCGTTGCCGTTGTTGCATTAGGTTTGCTCATCCCATTGGCACTTTACCCTGTGCTCACCCGCTTAGTTCGGCTTGGGCGCACTGATGCTATTAGCATCGCCGCCCATTATGGATCGGTCAGCGCGGGGACTTTTGCCGTTGTTATCGCCATGGTGGAAAAATCAGGGATGACATTAAGACCCGAAACAACTTTATATTTGGTGCTACTCGAACTACCAGCGATTGTGGTCATGCTCTGGTTA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CACAGATATTTAAGCGCCAAACAGCCG------------CTACAAGCTACAGTGCCTAATACTCAG---------------------------------------------CAATCGAGCATACTGCATGAAGCTTTAACTAGCCGCGGTGTGGTGCTCTTAGTCGGTGGAGTGGTCATTGGTTGGCTTTATGGTCCGACAGGACTTGCGGCCATTAGC---------CCTGTACTATTGGGTGGATTTAAAACCCTACTGGCCCTGTTTTTACTGGAGATGGGATTAGTCACGGCAAAAGTCTGTTTACCTCTACCACTGCAGCAATGGCGCTTATTAGTGTTTGCCGCCGTCACACCTTTTGCTTTGGCATGGTGCGGTATTGGTGTCGGG---------------------TTATGGCTC------GAGTTACCGCCGGGAAGCATCTTGGTGCTTGCAGGCTTGAGTGCCAGTGCCTCTTATATTGCAGCACCTGCAGCCATACGCGCCGCCATTCCCGAAGCTAATATTGGCCTCGCCATGCTGGCATCCCTTGGGATTACCTTTCCGGTGAACGTGTTAATCGGCTTACCCTTGTACCAACACTGGGTAATGCAAATTACG------GGA
TRN  10010101100011000
NAM  P73953_SYNY3/18-374
ASQ  PTLAFLIGGMVIAALGTQLVIPEAISTIIVFMLLTKIGLTGGMAIRN---SNLTE-MLLPVAFSVILGILIVFIARFTLAKLPNVRTVDALATGGLFGAVSGSTMAAALTTLEESKISYEAWAGALYPFMDIPALVTAIVVANIYLNKRKRKSAAA-----------------------------------SIEESFSKQPVAAGDYG----DQTDYPRTRQEYLSQQEPEDNRVKIWPIIEESLQGPALSAMLLGLALGIFTKPESVYE-----GFYDPLFRGLLSILMLIMGMEAWSRIGELRKVAQWYVVYSLIAPIVHGFIAFGLGMIAH---YAT--GFSLGGVVVLAVIAASSSDISGPPTLRAGIPSANPSAYIGSSTAIGTPIAIGVCIPLF-IGLAQTLGAG
DSQ  CCAACCCTAGCCTTTCTGATTGGGGGGATGGTTATTGCCGCCCTTGGCACCCAATTGGTAATTCCAGAGGCGATTTCTACGATCATCGTCTTTATGTTGCTCACTAAGATTGGCCTAACCGGGGGCATGGCAATTCGGAAC---------TCCAACTTGACGGAA---ATGCTCCTACCCGTGGCATTCTCTGTGATATTGGGAATTCTTATTGTCTTCATCGCCCGTTTTACCCTGGCTAAACTGCCTAACGTCAGAACCGTGGATGCCCTGGCCACCGGCGGCTTGTTTGGGGCAGTCAGTGGCTCTACAATGGCTGCCGCCCTCACTACGTTGGAAGAATCAAAAATTTCCTACGAAGCCTGGGCTGGTGCTCTGTATCCCTTTATGGATATTCCTGCCCTGGTAACGGCGATCGTCGTAGCTAATATTTATCTCAATAAGAGAAAACGTAAGTCTGCTGCTGCT---------------------------------------------------------------------------------------------------------AGTATTGAGGAATCGTTCAGCAAGCAACCCGTTGCCGCCGGGGATTATGGC------------GACCAAACGGATTATCCTCGTACCCGCCAAGAGTATTTAAGCCAGCAAGAACCGGAAGATAATCGGGTCAAAATCTGGCCAATTATCGAAGAAAGTTTACAAGGCCCTGCCCTATCAGCCATGTTGTTAGGTCTTGCCCTGGGCATATTTACCAAGCCGGAAAGTGTCTATGAA---------------GGTTTTTATGATCCTCTTTTTCGAGGACTACTTTCCATCTTGATGCTGATTATGGGCATGGAAGCTTGGTCCAGAATTGGTGAACTACGTAAAGTAGCTCAATGGTATGTGGTCTATAGCCTAATAGCTCCCATAGTGCACGGGTTTATTGCCTTTGGTCTTGGTATGATTGCCCAC---------TATGCTACG------GGTTTCAGTCTGGGTGGTGTGGTAGTTTTAGCAGTTATCGCCGCTTCTAGCTCTGATATCTCCGGGCCTCCTACCTTGCGAGCAGGTATCCCATCTGCCAACCCCTCTGCCTATATCGGTTCATCCACCGCCATCGGTACTCCCATTGCCATCGGCGTGTGCATACCGCTTTTC---ATTGGGCTTGCCCAGACCCTTGGTGCAGGT
TRN  10010101100011000
NAM  Q8YV47_ANASP/18-370
ASQ  PTLGFLIGGMVIAALGSELIIPEAICQIIVFMLLTKIGLTGGIAIRN---SNLTE-MVLPAASAVAVGVLVVFIARYTLAKLPKVNTVDAIATGGLFGAVSGSTMAAALTLLEEQKIQYEAWAAALYPFMDIPALVTAIVVANIYLNKKKRSAA---------------------------------------GEYLSKQSVAAGEYP----DQQDYPSSRQEYLRKQQSADNRVKIWPIVKESLQGPALSAMLLGIALGLFTQPESVYK-----SFYDPLFRGLLSILMLVMGMEAWSRIGELRKVAQWYVVYSVVAPLVHGFIAFGLGMIAH---YAT--GFSLGGVVILAVIAASSSDISGPPTLRAGIPSANPSAYIGASTAIGTPIAIGLAIPLF-LGLAQAIGGR
DSQ  CCAACACTTGGGTTTTTGATTGGTGGTATGGTCATTGCCGCTCTCGGTAGCGAATTGATAATTCCAGAGGCGATTTGTCAGATCATCGTCTTCATGTTGCTCACCAAAATCGGTCTGACCGGTGGTATTGCGATCCGCAAT---------TCCAACCTGACAGAG---ATGGTGTTACCCGCAGCGTCTGCTGTAGCAGTAGGGGTTCTTGTTGTATTCATCGCGCGCTATACCTTGGCCAAGCTGCCGAAGGTCAACACCGTAGATGCGATTGCGACCGGGGGGTTGTTTGGTGCTGTGAGTGGCTCTACCATGGCTGCCGCCCTGACGCTACTGGAAGAACAAAAAATCCAATACGAGGCATGGGCAGCCGCACTCTATCCCTTCATGGATATCCCCGCGCTCGTAACGGCGATTGTGGTGGCCAACATTTATCTCAACAAGAAGAAGCGTAGTGCAGCA---------------------------------------------------------------------------------------------------------------------GGCGAGTATCTCAGCAAGCAGAGTGTTGCAGCAGGCGAGTATCCC------------GATCAGCAGGATTATCCCAGCAGTCGGCAAGAGTATCTCCGCAAGCAGCAGTCTGCTGATAATCGGGTCAAAATATGGCCGATCGTCAAGGAAAGCCTCCAGGGCCCTGCCCTATCGGCAATGTTGCTCGGCATTGCTCTTGGCCTGTTCACCCAGCCGGAAAGTGTCTATAAA---------------AGCTTCTACGACCCCCTCTTCCGAGGCTTGCTTTCGATCTTGATGCTGGTTATGGGTATGGAGGCTTGGTCAAGGATTGGCGAACTACGGAAGGTAGCCCAGTGGTACGTTGTGTATAGCGTAGTGGCACCGTTGGTGCATGGGTTCATCGCCTTCGGTCTCGGCATGATTGCCCAC---------TACGCCACG------GGATTCAGCCTGGGCGGTGTTGTGATCCTGGCCGTCATCGCCGCCTCCAGTTCAGACATCTCAGGTCCACCCACGTTGCGAGCCGGAATTCCGTCGGCCAATCCCTCCGCCTACATCGGTGCCTCCACAGCTATCGGTACACCCATTGCCATTGGCTTGGCAATACCGCTCTTC---CTCGGTCTCGCCCAGGCGATAGGCGGCCGC
TRN  10010101100011000
//