EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05981 - CreA)
FAM  PF05981
PID  CreA
DES  CreA protein
IPR  IPR010292
ANO  10
ALN  156
AID  0.446459
APH  (((Q9HVM0_PSEAE/7-152:0.21333,CREA_ECOLI/8-157:0.23778):0.06491,Q8XZD0_RALSO/21-165:0.45338):0.18822,(((Q98KD2_RHILO/19-164:0.15889,(Q92NP0_RHIME/12-157:0.19575,Q8UDP5_AGRT5/11-156:0.18035):0.12892):0.08935,Q8FZQ9_BRUSU/12-157:0.23395):0.19440,(Q8EF15_SHEON/12-153:0.18762,Q8D7D6_VIBVU/7-149:0.29796):0.43863):0.40751,Q9JU13_NEIMA/7-155:0.59148);
ATP  (((Q9HVM0_PSEAE/7-152,CREA_ECOLI/8-157),Q8XZD0_RALSO/21-165),(((Q98KD2_RHILO/19-164,(Q92NP0_RHIME/12-157,Q8UDP5_AGRT5/11-156)),Q8FZQ9_BRUSU/12-157),(Q8EF15_SHEON/12-153,Q8D7D6_VIBVU/7-149)),Q9JU13_NEIMA/7-155);
ATL  4.26243
DNO  10
DLN  468
DID  0.510315
DPH  (((Q9HVM0_PSEAE/7-152:0.20979,Q8XZD0_RALSO/21-165:0.34743):0.07455,CREA_ECOLI/8-157:0.28449):0.09281,((Q98KD2_RHILO/19-164:0.12322,((Q92NP0_RHIME/12-157:0.20584,Q8UDP5_AGRT5/11-156:0.15802):0.06552,Q8FZQ9_BRUSU/12-157:0.26964):0.04639):0.13267,(Q8EF15_SHEON/12-153:0.23574,Q8D7D6_VIBVU/7-149:0.37793):0.30914):0.25495,Q9JU13_NEIMA/7-155:0.48771);
DTP  (((Q9HVM0_PSEAE/7-152,Q8XZD0_RALSO/21-165),CREA_ECOLI/8-157),((Q98KD2_RHILO/19-164,((Q92NP0_RHIME/12-157,Q8UDP5_AGRT5/11-156),Q8FZQ9_BRUSU/12-157)),(Q8EF15_SHEON/12-153,Q8D7D6_VIBVU/7-149)),Q9JU13_NEIMA/7-155);
DTL  3.67584
RID  0.446459
RPH  (((Q9HVM0_PSEAE/7-152:0.21333,CREA_ECOLI/8-157:0.23778):0.06491,Q8XZD0_RALSO/21-165:0.45338):0.18822,(((Q98KD2_RHILO/19-164:0.15889,(Q92NP0_RHIME/12-157:0.19575,Q8UDP5_AGRT5/11-156:0.18035):0.12892):0.08935,Q8FZQ9_BRUSU/12-157:0.23395):0.19440,(Q8EF15_SHEON/12-153:0.18762,Q8D7D6_VIBVU/7-149:0.29796):0.43863):0.40751,Q9JU13_NEIMA/7-155:0.59148);
RTP  (((Q9HVM0_PSEAE/7-152,CREA_ECOLI/8-157),Q8XZD0_RALSO/21-165),(((Q98KD2_RHILO/19-164,(Q92NP0_RHIME/12-157,Q8UDP5_AGRT5/11-156)),Q8FZQ9_BRUSU/12-157),(Q8EF15_SHEON/12-153,Q8D7D6_VIBVU/7-149)),Q9JU13_NEIMA/7-155);
RTL  4.26243
LNK  CREA_ECOLI/8-157:P08367:M13608
LNK  Q8D7D6_VIBVU/7-149:Q8D7D6:AE016808
LNK  Q8EF15_SHEON/12-153:Q8EF15:AE015661
LNK  Q8FZQ9_BRUSU/12-157:Q8FZQ9:AE014291
LNK  Q8UDP5_AGRT5/11-156:Q8UDP5:AE009158
LNK  Q8XZD0_RALSO/21-165:Q8XZD0:AL646064
LNK  Q92NP0_RHIME/12-157:Q92NP0:AL591789
LNK  Q98KD2_RHILO/19-164:Q98KD2:BA000012
LNK  Q9HVM0_PSEAE/7-152:Q9HVM0:AE004870
LNK  Q9JU13_NEIMA/7-155:Q9JU13:AL162756
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9JU13_NEIMA/7-155
ASQ  LSAAVLLTACGSGETDKIGRASTVFNIL-GKNDRIEVEGFDDPDVQGVACYISYAKKGG---LKEMVNLEEDASDASVSCVQTASSISFDE---TAVRKPKEVFKHGASFAFKSRQIVRYYDPKRKTFAYLVYSDKIIQGSPKNSLSAVSCFGGGI
DSQ  CTGTCTGCCGCCGTCCTGCTGACTGCCTGCGGCAGCGGCGAAACCGATAAAATCGGACGGGCAAGTACCGTTTTCAACATACTG---GGCAAAAACGACCGTATCGAAGTGGAAGGATTCGACGATCCCGACGTTCAAGGGGTTGCCTGTTATATTTCGTATGCAAAAAAAGGCGGC---------TTGAAGGAAATGGTCAATTTGGAAGAGGACGCGTCCGACGCATCGGTTTCGTGCGTTCAGACGGCATCTTCGATTTCTTTTGACGAA---------ACCGCCGTGCGCAAACCGAAAGAAGTTTTCAAACACGGTGCGAGCTTCGCGTTCAAGAGCCGGCAGATTGTCCGTTATTACGACCCCAAACGCAAAACCTTCGCCTATTTGGTGTACAGCGATAAAATCATCCAAGGCTCGCCGAAAAATTCCTTAAGCGCGGTTTCCTGTTTCGGCGGCGGCATA
TRN  10010101100011010
NAM  Q9HVM0_PSEAE/7-152
ASQ  LLGGLLLLPALA-GAEEIGEVSTVFKWV-GPNDKIVVEAFDDPKVQGVTCYLSR---AKTGGVKGGLGLAEDRAEASIACRQVGPIQFSG-----ELKDGEEVFKQRTSLVFKSMQVVRFFDRKRNALVYLVYSDRVIEGSPQNAVTAIPLMPWPT
DSQ  TTGCTGGGTGGTCTGCTGCTGTTGCCGGCGCTTGCC---GGGGCGGAGGAGATCGGCGAGGTTTCCACGGTGTTCAAGTGGGTC---GGGCCGAACGACAAGATTGTCGTCGAGGCTTTCGACGATCCCAAGGTGCAGGGCGTGACCTGCTATCTGTCGCGC---------GCCAAGACCGGTGGGGTCAAGGGCGGCCTGGGGCTGGCGGAGGATCGCGCCGAGGCGTCGATCGCCTGTCGCCAGGTGGGGCCGATCCAGTTCAGTGGC---------------GAACTCAAGGATGGCGAAGAGGTGTTCAAGCAGCGCACTTCGCTGGTGTTCAAAAGCATGCAGGTGGTGCGCTTCTTCGATCGCAAGCGCAATGCCTTGGTCTATCTGGTCTACAGCGACCGGGTGATCGAAGGTAGTCCGCAGAACGCGGTGACGGCGATTCCCCTCATGCCATGGCCGACC
TRN  11011101101011011
NAM  CREA_ECOLI/8-157
ASQ  LSLSLIMLGPLA-HAEEIGSVDTVFKMI-GPDHKIVVEAFDDPDVKNVTCYVSRAK---TGGIKGGLGLAEDTSDAAISCQQVGPIELSDRIK-NGKAQGEVVFKKRTSLVFKSLQVVRFYDAKRNALAYLAYSDKVVEGSPKNAISAVPVMPWRQ
DSQ  CTGTCTTTAAGCCTGATAATGCTGGGGCCATTGGCT---CATGCAGAAGAGATTGGTTCGGTCGACACCGTATTTAAAATGATC---GGCCCGGATCACAAAATTGTTGTGGAAGCCTTTGATGATCCCGATGTGAAAAATGTCACCTGTTATGTGAGCCGGGCGAAA---------ACCGGTGGTATTAAAGGGGGATTGGGTCTGGCGGAAGATACCTCCGATGCGGCCATTTCTTGTCAGCAAGTCGGGCCGATTGAACTGTCGGATCGTATTAAA---AACGGCAAAGCTCAGGGCGAGGTAGTATTCAAAAAACGCACGTCCCTGGTCTTTAAGTCGTTACAGGTCGTGCGCTTTTATGATGCCAAACGCAACGCGCTCGCTTATCTGGCTTACTCCGACAAAGTTGTAGAAGGTTCGCCGAAAAACGCGATTAGCGCGGTTCCTGTCATGCCGTGGCGGCAA
TRN  10010101100011010
NAM  Q8XZD0_RALSO/21-165
ASQ  ALLTAALLSTTA-SAEDIGSVNTNFRIT-GSD-KIVIEAFDDPLVGGVTCYVSRARTGGI---KGTLGVAEDVSEASVACRQVGEIRF-----VKPLPQQDDMFTQRLSLIFKTLHVVRTVDRKRNVLVYLTYSDKVISGSPKNSVTAVPIPAGQP
DSQ  GCCCTGCTCACCGCCGCCCTGCTGTCGACCACCGCC---TCCGCCGAGGACATCGGCAGCGTCAATACCAACTTCCGCATCACC---GGGTCAGAC---AAGATCGTTATCGAAGCCTTCGATGATCCGCTGGTGGGCGGCGTCACCTGCTATGTATCGCGCGCCCGCACGGGCGGCATC---------AAGGGCACCCTGGGTGTGGCCGAAGACGTGAGCGAAGCCTCGGTGGCCTGCCGGCAGGTCGGCGAGATCCGCTTC---------------GTCAAGCCGCTGCCGCAGCAGGACGACATGTTCACGCAGCGCCTGTCGCTGATCTTCAAGACGCTGCACGTGGTGCGCACGGTGGATCGCAAGCGCAACGTGCTGGTCTACCTGACCTATTCCGACAAGGTCATTTCCGGCAGCCCCAAGAACAGTGTGACGGCGGTGCCGATCCCGGCCGGCCAGCCG
TRN  11011111101111101
NAM  Q98KD2_RHILO/19-164
ASQ  LAACVVLGAGSA-VAEEVGKVGV--DWV-GND--IIVEAIKDPKVDGVTCHVSYFDRSIIDRLHKG-NWFEDPSDSSISCRQTGPITIGD---IDMSEGGEEVFKQGISLIWKKQVVNRIYDKTNETLIYLSHSRQVQNGSAKMSVTTVPLYGQNV
DSQ  TTGGCCGCGTGCGTCGTGCTTGGCGCCGGCAGCGCC---GTCGCCGAGGAAGTCGGTAAGGTCGGCGTC------GACTGGGTC---GGCAATGAC------ATCATCGTCGAAGCGATCAAGGATCCGAAAGTGGATGGCGTGACCTGCCATGTGTCCTATTTCGACCGCAGCATCATCGACCGCCTGCACAAGGGC---AACTGGTTCGAGGATCCCTCCGATTCGTCGATCTCCTGCCGCCAGACCGGACCGATCACCATTGGCGAC---------ATCGACATGAGCGAGGGCGGCGAGGAGGTGTTCAAGCAAGGCATCAGCCTTATCTGGAAGAAGCAGGTGGTGAACCGCATCTACGACAAGACCAACGAGACGCTGATCTATCTCTCGCATTCGCGCCAGGTCCAGAACGGCTCGGCCAAGATGTCGGTCACCACAGTGCCGCTCTACGGCCAGAACGTG
TRN  11011101101011011
NAM  Q92NP0_RHIME/12-157
ASQ  GLTVSAAAVSPV-HAETVGQVGV--DWL-GND--IKIDAVSDPKVTGVTCHVTYFDRSVIDRLKNG-NWFEDPSNNSIACRQTGPIAIDD---IDLSKEGEEVFRSGLSLIWKNLLVTRIYDKANDTLIYLAHSRQLTDGSAKMSITTVPLYGQSV
DSQ  GGCCTCACCGTCTCGGCCGCGGCGGTTTCGCCGGTC---CACGCCGAAACCGTTGGCCAGGTCGGGGTC------GACTGGCTC---GGCAACGAC------ATCAAGATCGATGCCGTAAGCGACCCGAAGGTGACCGGGGTTACCTGCCACGTCACCTATTTCGATCGCAGCGTCATCGACCGCCTGAAGAACGGC---AACTGGTTCGAGGATCCGTCGAACAACTCCATCGCCTGCCGCCAGACCGGCCCCATCGCCATCGATGAT---------ATCGACCTGTCGAAGGAGGGAGAGGAAGTCTTCCGTTCCGGACTGTCTCTCATCTGGAAGAACCTGCTGGTGACCCGCATCTACGACAAGGCCAACGACACGCTGATCTATCTGGCGCATTCGAGGCAGTTGACCGACGGATCGGCCAAGATGTCGATCACCACGGTCCCGCTCTATGGCCAATCGGTC
TRN  10010101100011011
NAM  Q8UDP5_AGRT5/11-156
ASQ  AGLLALLPVTAA-HSEVVGKVGV--DWI-GND--IVIEAIADPKIKGVTCHVTYFDRGVIDRLKNG-NWFEDPSNNAISCSQTGPVEIGD---IDLSKGGEEVFRQGMSLIWKKLVVSRVYDKANDTLIYLVHARELKDGSAKMAISTVPLYNQQV
DSQ  GCGGGCCTTCTGGCATTGCTGCCGGTAACAGCGGCG---CATTCCGAGGTCGTTGGCAAGGTTGGCGTC------GACTGGATC---GGCAATGAC------ATCGTCATCGAGGCGATCGCCGATCCGAAGATCAAGGGTGTGACCTGCCACGTTACCTATTTCGACCGCGGCGTGATCGACCGGCTGAAGAACGGC---AACTGGTTCGAAGACCCTTCCAATAACGCCATTTCCTGCAGCCAGACGGGGCCGGTGGAGATCGGCGAT---------ATCGATCTCTCCAAGGGCGGGGAAGAGGTGTTCCGGCAGGGCATGTCGCTGATCTGGAAAAAGCTCGTCGTCAGCCGCGTCTATGACAAGGCGAATGATACGCTGATCTACCTCGTGCACGCGCGCGAGCTGAAGGACGGATCGGCCAAGATGGCGATTTCGACGGTGCCGCTTTATAACCAGCAGGTA
TRN  11011101101011011
NAM  Q8FZQ9_BRUSU/12-157
ASQ  LAPMLVFAASAA-PAEEVGKVGV--DWF-GND--IVVDAVHDPKVKGITCYLASFSRGMIDRLQKG-NWFENPSNASISCEQTGPIVIGD---IKLGKGGERVFAERTSLIWKKLVITRIYDKTNNTLLYLAHATQVQDGSAKTSLSTVPLYKGDV
DSQ  CTTGCTCCGATGCTTGTTTTTGCTGCTTCGGCGGCG---CCAGCGGAAGAGGTTGGCAAGGTCGGTGTG------GACTGGTTC---GGCAATGAT------ATCGTTGTCGATGCGGTGCATGACCCGAAGGTCAAGGGCATCACCTGCTATCTTGCATCGTTCTCACGCGGGATGATCGACAGATTGCAGAAGGGC---AACTGGTTTGAAAACCCGTCCAATGCGTCCATTTCCTGCGAGCAGACCGGGCCGATCGTCATTGGCGAT---------ATCAAGCTTGGCAAGGGTGGGGAACGTGTCTTTGCCGAGCGCACCAGCCTGATCTGGAAAAAACTGGTCATTACCCGCATCTACGACAAGACCAATAATACGCTGCTTTATCTCGCCCATGCCACACAGGTGCAGGACGGTTCGGCCAAGACTTCGCTTTCTACCGTGCCGCTCTATAAGGGTGATGTG
TRN  10010101100011001
NAM  Q8EF15_SHEON/12-153
ASQ  LAVTLTGMMLSG-CGDDVGKVSL--GLFTTKD--VIIDAKQDPKIPGVTCHISRIEANL---------DFADPSDMGISCRQTGPISAADIAKIDKSKNGEVVFTESLSILFKTLKVRRIYDAPNQTLLYLSYSTKETNGSHKHALSTVPLFGSQA
DSQ  CTGGCAGTGACGTTGACAGGCATGATGCTTTCGGGC---TGTGGTGATGATGTGGGTAAAGTGAGCCTC------GGGCTCTTTACCACGAAAGAC------GTGATTATCGATGCCAAGCAAGACCCGAAAATCCCTGGTGTGACCTGTCATATCAGCCGCATTGAAGCGAACCTT---------------------------GATTTTGCCGATCCGTCCGATATGGGCATTAGTTGCCGTCAAACCGGGCCGATTTCCGCCGCAGATATTGCCAAGATAGATAAGAGCAAAAACGGTGAAGTGGTGTTCACCGAGTCTTTAAGTATTTTATTTAAAACGCTAAAAGTGCGCCGGATTTACGATGCGCCTAATCAAACGCTGTTGTATTTGTCCTATTCGACGAAAGAGACGAATGGCAGCCATAAACATGCTTTGTCAACTGTGCCTTTATTTGGCTCACAGGCG
TRN  10010101100011000
NAM  Q8D7D6_VIBVU/7-149
ASQ  TAVFATTALLSGCGGNEVGDVGL--GWFTLKD--IKITSLQDEVVTGVTCHIASIEANL---------SLSDPSDSSISCRQTGSITPEMIAKIDKSSSGEVVFKQSKSIFFKTMKVRRIYDQKNQTLLYLSYTTKETEGSFKHSLSTVPLWGTDA
DSQ  ACCGCTGTTTTCGCGACAACAGCCCTTCTTTCAGGGTGTGGTGGCAACGAGGTCGGTGACGTAGGCTTG------GGGTGGTTTACCCTAAAGGAC------ATTAAAATCACCTCGCTACAAGATGAAGTGGTCACCGGCGTAACGTGTCACATCGCTTCAATTGAGGCAAACTTA---------------------------AGCCTATCCGATCCTAGTGACAGCTCTATCTCTTGCCGCCAGACCGGCAGTATTACACCGGAAATGATCGCCAAGATTGACAAAAGCTCGTCGGGCGAAGTGGTGTTCAAGCAGTCAAAAAGTATCTTTTTTAAAACAATGAAGGTTCGTCGTATTTACGATCAAAAGAACCAGACCCTACTCTACCTTTCGTACACAACCAAAGAAACCGAAGGTAGCTTCAAACATAGCTTATCAACGGTCCCGCTTTGGGGGACTGACGCC
TRN  11011101111011000
//