EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05971 - Methyltransf_10)
FAM  PF05971
PID  Methyltransf_10
DES  Protein of unknown function (DUF890)
IPR  IPR010286
ANO  6
ALN  316
AID  0.410382
APH  ((Q9KRM2_VIBCH/43-350:0.35055,((Q8X7W6_ECO57/29-323:0.26490,Q8ZDP0_YERPE/23-323:0.35658):0.16118,Q9HXG4_PSEAE/13-314:0.33314):0.07457):0.79217,Q96T16_HUMAN/1-291:0.42831,Q9V790_DROME/7-297:0.49713);
ATP  ((Q9KRM2_VIBCH/43-350,((Q8X7W6_ECO57/29-323,Q8ZDP0_YERPE/23-323),Q9HXG4_PSEAE/13-314)),Q96T16_HUMAN/1-291,Q9V790_DROME/7-297);
ATL  3.25852
DNO  6
DLN  948
DID  0.481723
DPH  ((Q9KRM2_VIBCH/43-350:0.27439,(Q96T16_HUMAN/1-291:0.43906,Q9V790_DROME/7-297:0.40535):0.43590):0.11573,Q9HXG4_PSEAE/13-314:0.36542,(Q8X7W6_ECO57/29-323:0.26658,Q8ZDP0_YERPE/23-323:0.34080):0.09649);
DTP  ((Q9KRM2_VIBCH/43-350,(Q96T16_HUMAN/1-291,Q9V790_DROME/7-297)),Q9HXG4_PSEAE/13-314,(Q8X7W6_ECO57/29-323,Q8ZDP0_YERPE/23-323));
DTL  2.73972
RID  0.410382
RPH  ((Q9KRM2_VIBCH/43-350:0.35055,((Q8X7W6_ECO57/29-323:0.26490,Q8ZDP0_YERPE/23-323:0.35658):0.16118,Q9HXG4_PSEAE/13-314:0.33314):0.07457):0.79217,Q96T16_HUMAN/1-291:0.42831,Q9V790_DROME/7-297:0.49713);
RTP  ((Q9KRM2_VIBCH/43-350,((Q8X7W6_ECO57/29-323,Q8ZDP0_YERPE/23-323),Q9HXG4_PSEAE/13-314)),Q96T16_HUMAN/1-291,Q9V790_DROME/7-297);
RTL  3.25852
LNK  Q8X7W6_ECO57/29-323:Q8X7W6:AE005174
LNK  Q8ZDP0_YERPE/23-323:Q8ZDP0:AJ414152
LNK  Q96T16_HUMAN/1-291:Q96T16:AK027410
LNK  Q9HXG4_PSEAE/13-314:Q9HXG4:AE004801
LNK  Q9KRM2_VIBCH/43-350:Q9KRM2:AE004238
LNK  Q9V790_DROME/7-297:Q9V790:AE003812
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9V790_DROME/7-297
ASQ  NQKIVGMHPRNVLRTQP-DYTKMAIKYKDFRQQCQLELNGKVSVNFRNEKTLRELTKMLLKEYYDLDV-DFAPGSLVPTLALRLNYILWLEDLMEPLNLQ------NIRGIDIGCGSSCIYSLLGAKKNGWHMLALESKPQNIEYAKENVKRN-HMESLIEVYAQPDNTNIFKSYFEQDQQQLQYQFCLCNPPFFDSNLPNPLGGNTRNPE--RRP--------------APNNARTGSQEELTCVGGEVQFVQRIIDESLENKERVRIFTTMLGVKANVPRILDYLKELQVANVSTTEFHQGHTTRWAVAWSFHS
DSQ  AACCAAAAGATAGTCGGCATGCATCCACGTAATGTGTTACGCACGCAGCCC---GACTATACCAAAATGGCTATAAAATACAAAGATTTTCGGCAGCAGTGCCAGTTGGAGCTCAATGGCAAGGTTTCTGTGAACTTTCGCAATGAAAAGACCCTTCGTGAGTTGACCAAAATGCTGTTGAAGGAATATTACGATTTAGATGTG---GATTTTGCACCCGGAAGTTTGGTGCCCACATTAGCACTACGTTTGAATTACATTTTGTGGTTGGAGGATCTAATGGAACCTCTAAATTTGCAG------------------AACATACGTGGTATAGATATAGGCTGCGGCTCCTCCTGCATTTATTCACTCCTTGGGGCCAAGAAAAATGGTTGGCACATGTTGGCTTTGGAATCGAAACCGCAAAACATAGAATACGCCAAGGAGAATGTAAAGAGAAAT---CACATGGAAAGCCTTATAGAAGTCTATGCTCAACCAGACAACACGAACATCTTTAAGAGCTATTTTGAGCAGGATCAGCAACAGTTGCAGTATCAATTTTGCCTGTGCAATCCACCCTTCTTCGACTCGAACTTACCAAATCCCTTAGGCGGCAATACCAGGAATCCAGAG------AGACGACCA------------------------------------------GCACCCAATAATGCCAGAACTGGAAGCCAGGAGGAACTCACCTGCGTGGGTGGCGAGGTACAGTTTGTGCAACGCATTATAGACGAGAGTCTGGAGAACAAGGAGCGTGTGCGAATCTTCACCACGATGCTGGGCGTCAAGGCCAACGTTCCAAGAATACTGGATTACCTCAAGGAGCTGCAGGTGGCGAATGTCAGCACCACTGAATTCCATCAGGGACACACGACTCGGTGGGCGGTGGCCTGGAGCTTCCACTCG
TRN  10010101100011000
NAM  Q96T16_HUMAN/1-291
ASQ  MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLDGRVSLNFKDPEAVRALTCTLLREDFGLSI-DIPLERLIPTVPLRLNYIHWVEDLIGHQDSD-KST--LRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQN-NLSDLIKVVKVPQKTLLMDAL--KEESEIIYDFCMCNPPFFANQLEAK-GVNSRNP---RRP--------------PPSSVNTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYD
DSQ  ATGGCTCTGAGTAAATCAATGCATGCAAGAAATAGATACAAGGACAAACCTCCTGACTTTGCATATCTGGCATCCAAATATCCAGATTTTAAGCAGCATGTTCAGATAAATCTGGATGGAAGAGTGAGCCTTAATTTTAAAGACCCCGAAGCAGTCAGAGCTCTGACGTGTACTCTCCTAAGGGAAGATTTTGGACTTTCTATT---GATATTCCATTGGAGAGACTAATTCCCACAGTTCCCTTGAGACTCAACTATATTCACTGGGTAGAAGATCTGATCGGTCACCAGGATTCTGAC---AAAAGTACT------CTCCGAAGAGGAATTGACATAGGCACGGGGGCATCTTGCATCTACCCCTTACTTGGAGCAACCTTGAATGGCTGGTATTTCCTCGCAACAGAAGTGGATGATATGTGTTTCAACTATGCAAAGAAAAATGTGGAACAGAAT---AACTTATCTGATCTCATAAAAGTGGTGAAGGTGCCACAGAAGACACTCCTGATGGATGCTCTT------AAAGAAGAATCTGAGATAATCTATGACTTTTGCATGTGCAACCCTCCCTTTTTTGCCAATCAATTGGAAGCCAAG---GGAGTAAACTCACGAAATCCT---------CGAAGACCT------------------------------------------CCGCCTAGTTCTGTTAATACAGGAGGCATCACAGAGATCATGGCAGAAGGAGGTGAATTAGAGTTTGTTAAAAGGATCATCCATGACAGTCTACAACTTAAAAAAAGATTAAGATGGTATAGCTGCATGCTGGGAAAGAAATGCAGCCTGGCGCCCCTGAAGGAGGAGCTTCGCATACAAGGGGTTCCCAAAGTAACGTACACTGAATTCTGTCAAGGTCGGACAATGAGATGGGCCTTAGCTTGGAGTTTTTATGAT
TRN  10010101100011000
NAM  Q9KRM2_VIBCH/43-350
ASQ  AAVKSGLHPRNRHRGQY-DFPALIKVVPELQSHVMKNPKGQWTINFADPISVKLLNKALLVLHYGVTYWDIPEGFLCPPIPGRADYIHRVADLLLKGNPQL--NHSQVRALDIGVGANCIYPIVGVTEYGWSWVGSDVDPVSIQQASLIVQSNSKLQGHIECRLQKNSQHIFNGIIG--ANE-RYTVTTCNPPFHASLADAQ-QGTQRKLTNL-QANQRKKGRLATPTLSHSRLNFGGQKAELWCPGGEAAFIGKMAVESQQFAQQVLWFRTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQKISRFIAWSFQN
DSQ  GCTGCCGTTAAATCTGGATTACATCCACGTAATCGTCACCGCGGGCAGTAT---GATTTTCCGGCACTGATTAAGGTCGTGCCAGAGTTGCAATCCCATGTGATGAAAAATCCTAAAGGGCAATGGACGATTAATTTTGCCGATCCGATCTCGGTCAAGTTACTCAATAAAGCGCTTTTGGTTCTGCATTACGGTGTCACCTATTGGGATATCCCAGAGGGCTTTTTATGCCCGCCCATTCCGGGTCGTGCGGATTACATTCATCGCGTGGCCGATCTATTGCTTAAAGGCAATCCCCAATTA------AACCACTCTCAAGTCAGAGCACTGGATATTGGCGTGGGCGCAAATTGTATCTATCCGATTGTTGGAGTGACGGAATATGGCTGGTCATGGGTTGGCAGTGATGTTGATCCTGTTTCAATTCAACAAGCGAGTTTGATTGTTCAAAGCAACTCGAAGCTGCAAGGCCATATCGAATGCCGCCTGCAAAAGAACAGCCAACATATTTTTAACGGCATTATTGGG------GCGAATGAG---CGTTATACGGTGACGACTTGCAACCCGCCTTTTCATGCATCCTTAGCGGACGCTCAG---CAAGGAACCCAGCGTAAGTTGACCAACTTA---CAAGCAAATCAGCGCAAGAAAGGCCGCTTAGCAACGCCAACGTTAAGCCACTCAAGGTTAAATTTTGGTGGTCAGAAAGCCGAGTTATGGTGTCCAGGAGGAGAAGCGGCTTTCATTGGTAAAATGGCGGTAGAAAGCCAGCAGTTCGCGCAGCAAGTGCTTTGGTTTAGAACTTTGATTTCTAAAGGTGATAACGTTCGTGGCATGAAAAAACAGCTGGAAAAACTCGGGGCTCAGTCGATACATGTAATAGAGATGGCACAAGGGCAGAAGATAAGTCGCTTTATTGCTTGGAGTTTTCAAAAT
TRN  10010101100011000
NAM  Q9HXG4_PSEAE/13-314
ASQ  RKSASPLHPRNRHLGRY-DFPRLIAGSPELERFVILNPYGRQSIDFADPAAVKAFNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGASHDGLIPRGPGLRALDVGTGANCIYPLLGHHEYGWRFVGADIDPQSLASAAAILAANPRFAAAIELRRQPDRRQIFQGLIG--VDE-RFDMTLCNPPFHASLDEAT-RGSRRKWKNLGKLDP---------TRTLPLLNFGGQGAELYCEGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQKQSRFVAWTYLD
DSQ  CGCAAGAGCGCCAGCCCGCTGCACCCGCGCAATCGCCACCTGGGACGCTAC---GACTTTCCGCGCCTGATCGCCGGCAGCCCGGAACTGGAGCGCTTCGTCATCCTCAATCCGTACGGCAGGCAGAGCATCGACTTCGCCGATCCGGCGGCGGTGAAAGCCTTCAACCGCGCGCTGCTGCAACAGTTCTACGACGTACGCGAGTGGGATATACCCGATGGTTACCTGTGCCCGCCCATCCCCGGTCGCGCCGACTACCTGCACTACCTGGCCGACCTGCTCGGCGCCAGCCACGATGGCCTGATTCCACGCGGTCCCGGCCTGCGTGCGCTGGACGTCGGAACCGGAGCCAACTGCATCTACCCGCTGCTCGGCCACCACGAATACGGCTGGCGCTTCGTCGGCGCCGACATCGACCCGCAATCGCTGGCCTCGGCCGCTGCGATCCTCGCCGCCAACCCACGCTTCGCCGCTGCCATCGAGTTGCGCCGGCAGCCTGATCGCAGGCAGATATTCCAGGGCCTGATCGGC------GTCGATGAG---CGCTTCGACATGACCCTCTGCAACCCGCCCTTCCACGCCTCGCTGGACGAAGCCACG---CGCGGCAGCCGGCGCAAGTGGAAGAACCTCGGCAAGCTCGACCCG---------------------------ACCCGTACCCTGCCGCTACTGAACTTTGGCGGCCAGGGCGCCGAGCTGTACTGCGAGGGCGGCGAAGCGGCCTTCCTGGCCGGCATGGCCGAGGAAAGCCGGGCGTTCGCCACGCAGGTGTTCTGGTTCACCACCCTGGTATCCAAGGCGAGCAACCTGCCGAACCTCCAGGAGCGCCTGAAGACGTTGGGCGCCAGCGATATCCGCGTGGTGGACATGGCCCAGGGACAGAAGCAGAGCCGTTTCGTCGCCTGGACCTACCTCGAC
TRN  10010101100011011
NAM  Q8ZDP0_YERPE/23-323
ASQ  PKEKSGLHPRNRHCSRY-DFDALSVSCPELIPFLAPTAYGDISVDFADPLAVKMLNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLASCNGEVIPKGKNIALLDIGVGANCIYPIIGQREYGWRFTGTDIDSHALSAAKMVVSMNPTLKNTLRLKQQKDPHAIFEGVWA--VNE-RYDATLCNPPFHGSAEEAA-ATTRRKLHKLGK-NE---------VAAKPVQNFGGKNSELWCEGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQKVSRFVAWTFLT
DSQ  CCCAAAGAAAAAAGCGGATTGCATCCCCGAAATCGTCATTGCTCACGCTAT---GATTTTGATGCGCTTTCAGTGAGTTGCCCTGAGCTAATCCCTTTTCTGGCCCCGACCGCCTATGGTGATATTTCTGTCGATTTTGCTGATCCATTAGCAGTAAAAATGTTGAATAAGGCATTATTAAAACATTTCTATGGCATTGAATATTGGGACATTCCAGCCGATTCTTTATGTCCTCCCATTCCTGGGCGTGCCGATTACGTGCACCATCTGGCCGATCTATTAGCCAGTTGCAATGGCGAGGTGATCCCTAAGGGCAAGAATATTGCGTTGCTGGATATTGGCGTCGGCGCTAACTGTATTTACCCAATTATTGGTCAGCGGGAGTACGGCTGGCGTTTTACCGGTACGGATATTGACTCACACGCGCTCAGTGCGGCAAAAATGGTGGTGTCGATGAACCCGACCCTGAAAAATACCTTGCGCCTGAAGCAGCAAAAAGATCCACACGCTATTTTTGAAGGGGTGTGGGCG------GTGAATGAG---CGTTACGATGCGACGCTGTGTAACCCGCCATTCCATGGTTCAGCAGAAGAAGCGGCG---GCCACCACTCGCCGTAAATTGCACAAACTGGGGAAA---AATGAA---------------------------GTCGCTGCAAAGCCAGTACAGAACTTCGGTGGTAAAAACAGTGAGTTATGGTGTGAAGGTGGGGAGGAAGGGTTTGTCAGCCGCATGGTGGCAGAGAGCGTAGCGAAAGCGCAGAACTGTTTCTGGTTTACCTCATTGATTTCCAAGAAGACCACGTTACCGGCGATTTATCATGCTCTAAGATATGTGAAGGCAGTTGAGGTGCGCACTATTGAGATGGCGCAAGGGCAAAAAGTCAGTCGGTTTGTGGCCTGGACGTTCCTGACG
TRN  10010101100011000
NAM  Q8X7W6_ECO57/29-323
ASQ  SAQKPGLHPRNRHHSRY-DLATLCQVNPELKQFLTLTPAGEQSVDFANPLAVKALNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAEASGT-IPA--NASILDIGVGANCIYPLIGVHEYGWRFTGSETSSQALSSAQAIISANPGLNRAIRLRRQKESGAIFNGIIH--KNE-QYDATLCNPPFHDSAAAAR-AGSECKRRNLGL-NK---------DDA---LNFGGQQQELWCEGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQKQSRFIAWTFMN
DSQ  TCCGCCCAGAAACCGGGGTTGCATCCGCGCAACCGTCATCACAGCCGCTAC---GATCTCGCCACGCTTTGTCAGGTCAATCCTGAACTCAAGCAATTCCTCACGCTTACACCCGCCGGGGAGCAAAGCGTAGACTTTGCCAATCCGCTGGCGGTGAAGGCGCTCAATAAGGCGTTGCTGGCCCATTTTTACGCCGTAGCGAACTGGGATATCCCGGACGGTTTTCTCTGCCCGCCAGTACCGGGCCGGGCGGATTATATTCATCACCTTGCCGATTTACTGGCTGAAGCAAGCGGAACA---ATTCCAGCT------AATGCCAGCATTCTTGATATCGGCGTTGGTGCGAACTGTATTTATCCGCTGATTGGCGTACATGAATATGGCTGGCGTTTTACCGGTAGTGAAACCAGCAGCCAGGCGTTAAGCAGCGCGCAGGCGATCATCAGTGCTAATCCGGGGCTTAATCGCGCCATTCGTCTGCGTCGGCAAAAAGAGAGTGGGGCGATTTTTAACGGCATCATCCAT------AAAAACGAG---CAATACGACGCGACCTTGTGTAACCCGCCATTCCACGATTCCGCCGCTGCGGCGCGG---GCAGGTAGTGAGTGTAAACGCCGTAACCTGGGGCTG---AACAAA---------------------------GACGATGCA---------CTGAACTTTGGCGGCCAGCAACAGGAGTTGTGGTGTGAAGGCGGTGAGGTCACCTTTATCAAAAAGATGATTGAAGAGAGCAAAGGCTTCGCGAAGCAGGTGATGTGGTTTACTTCACTGGTATCTCGTGGTGAAAACTTACCGCCGTTGTATCGTGCCCTGACGGACGTGGGCGCGGTGAAGGTGGTTAAAAAAGAGATGGCCCAGGGGCAAAAGCAGAGTCGCTTTATTGCCTGGACCTTTATGAAC
TRN  11011101101011000
//