EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05966 - Chordopox_A33R)
FAM  PF05966
PID  Chordopox_A33R
DES  Chordopoxvirus A33R protein
IPR  IPR009238
ANO  6
ALN  198
AID  0.441049
APH  (Q91MP2_LSDV/6-196:0.60285,(Q8V3H7_SWPV/1-185:0.58924,Q9DHJ1_YLDV/8-186:0.44080):0.09338,(O57236_9POXV/1-185:0.83705,(Q9Q8I0_9POXV/1-175:0.15346,Q9Q8V7_9POXV/1-172:0.11370):0.41046):0.30155);
ATP  (Q91MP2_LSDV/6-196,(Q8V3H7_SWPV/1-185,Q9DHJ1_YLDV/8-186),(O57236_9POXV/1-185,(Q9Q8I0_9POXV/1-175,Q9Q8V7_9POXV/1-172)));
ATL  3.54249
DNO  6
DLN  594
DID  0.522375
DPH  (Q9Q8I0_9POXV/1-175:0.16266,(((Q9DHJ1_YLDV/8-186:0.29603,Q91MP2_LSDV/6-196:0.39875):0.07588,Q8V3H7_SWPV/1-185:0.36087):0.15918,O57236_9POXV/1-185:0.57209):0.30736,Q9Q8V7_9POXV/1-172:0.09886);
DTP  (Q9Q8I0_9POXV/1-175,(((Q9DHJ1_YLDV/8-186,Q91MP2_LSDV/6-196),Q8V3H7_SWPV/1-185),O57236_9POXV/1-185),Q9Q8V7_9POXV/1-172);
DTL  2.43168
RID  0.441049
RPH  (Q91MP2_LSDV/6-196:0.60285,(Q8V3H7_SWPV/1-185:0.58924,Q9DHJ1_YLDV/8-186:0.44080):0.09338,(O57236_9POXV/1-185:0.83705,(Q9Q8I0_9POXV/1-175:0.15346,Q9Q8V7_9POXV/1-172:0.11370):0.41046):0.30155);
RTP  (Q91MP2_LSDV/6-196,(Q8V3H7_SWPV/1-185,Q9DHJ1_YLDV/8-186),(O57236_9POXV/1-185,(Q9Q8I0_9POXV/1-175,Q9Q8V7_9POXV/1-172)));
RTL  3.54249
LNK  O57236_9POXV/1-185:O57236:U94848
LNK  Q8V3H7_SWPV/1-185:Q8V3H7:AF410153
LNK  Q91MP2_LSDV/6-196:Q91MP2:AF325528
LNK  Q9DHJ1_YLDV/8-186:Q9DHJ1:AJ293568
LNK  Q9Q8I0_9POXV/1-175:Q9Q8I0:AF170726
LNK  Q9Q8V7_9POXV/1-172:Q9Q8V7:AF170722
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Q8V7_9POXV/1-172
ASQ  MSLQEN-DVEDSKDEGAAFIGSTIYGNKLKKKHL-I-KKVKCVSILLRVSIVTSIVSLMAITAILALQCSTCDVV-----------------KTSAHISSSINQY--ESECKGIVFDSACYTLHKEPKTFYEASEDCANQSAVLPFKT-LKDHWMWDYLEGTWGVDGYGIVELV---DLNTYDVSVEMRKYFCVKSFT
DSQ  ATGTCGTTACAAGAGAAC---GACGTGGAAGATTCGAAAGACGAAGGCGCCGCCTTCATAGGTTCCACAATTTATGGTAATAAACTAAAGAAGAAACATCTT---ATT---AAAAAGGTTAAATGTGTCTCGATCCTGTTGCGTGTAAGTATTGTGACATCCATCGTGTCACTTATGGCGATTACCGCGATATTGGCGCTACAGTGTAGCACCTGTGATGTTGTT---------------------------------------------------AAGACTTCGGCGCATATTTCTTCTTCCATCAATCAATAC------GAAAGTGAATGTAAAGGTATCGTGTTCGACTCTGCCTGTTATACTCTACACAAGGAACCTAAAACGTTTTACGAAGCTAGCGAAGATTGTGCCAATCAAAGCGCAGTGTTACCCTTCAAAACG---CTTAAGGATCACTGGATGTGGGATTATCTGGAGGGTACCTGGGGAGTGGATGGGTACGGCATCGTCGAGCTTGTG---------GACCTTAATACATACGACGTGAGTGTAGAAATGAGAAAATATTTTTGTGTAAAATCATTTACT
TRN  10010101100011000
NAM  Q9Q8I0_9POXV/1-175
ASQ  -MSLHANDADESKDEEAAFIGSTIYGKKLKKKHL-L-KKVRCIVILLRVSIVTSIVSLMAIAAMLALQCSNCEVITTSARISTYSSIA----------------HYEASTCKGIVFDASCYMFHKEPKTFYEAGADCANQSAVLPFKT-PKEHWMWDYLEGTWGVDGYGIVDSV---DLRTYDVSTEMRKYFCVKSFT
DSQ  ---ATGTCGTTACACGCCAACGACGCGGACGAGTCGAAGGACGAAGAAGCTGCGTTCATCGGTTCCACAATTTACGGCAAGAAACTAAAGAAGAAACACCTG---CTC---AAAAAAGTCAGATGTATCGTGATCCTGCTGCGTGTAAGCATCGTTACGTCCATCGTGTCGCTTATGGCAATTGCCGCCATGTTAGCATTACAGTGCAGTAACTGCGAGGTCATTACGACATCGGCTCGTATATCGACGTATTCTTCCATTGCC------------------------------------------------CATTACGAGGCGAGTACGTGCAAAGGGATCGTCTTCGACGCGAGCTGTTATATGTTTCACAAAGAACCCAAAACGTTCTACGAGGCCGGGGCGGATTGCGCCAATCAAAGTGCCGTATTGCCTTTCAAAACA---CCTAAGGAGCATTGGATGTGGGATTATCTGGAAGGTACCTGGGGGGTGGACGGATACGGAATCGTTGACTCGGTG---------GACCTTCGGACCTACGACGTGAGTACAGAAATGAGAAAATATTTTTGCGTAAAATCATTTACT
TRN  10010101100011000
NAM  Q9DHJ1_YLDV/8-186
ASQ  VNLDIEGDKLNSNENTNAFTGSTIYGSKLKKEKNTKSKKNKFFGLCIRISIIISILSLMAITITLSLQVNKYKSMVELNKDLNDASVSLSN-----------------AECRGLVYGNNCFIFNSEPKTFDEALSDCNTKNYFLPPTN-IMTSWLSDYLEDTWSEEGTSLLKSNIEFNSDDIDISTEMRKYFCVKSF-
DSQ  GTAAACTTAGATATAGAAGGTGATAAGTTAAACTCAAATGAAAACACTAACGCTTTTACTGGATCAACAATTTATGGCTCTAAGCTTAAAAAAGAAAAAAACACTAAAAGTAAAAAAAATAAATTTTTTGGTTTATGTATTAGAATATCTATTATAATATCTATTTTGTCTCTTATGGCAATAACAATTACTTTATCACTACAAGTCAATAAATACAAATCAATGGTAGAGTTAAATAAAGATCTAAACGACGCATCGGTTTCTTTAAGCAAT---------------------------------------------------GCTGAATGTAGGGGGCTTGTTTACGGTAACAATTGTTTTATTTTTAATTCAGAACCAAAAACATTTGATGAAGCACTAAGTGATTGTAATACAAAAAATTATTTTTTGCCACCAACAAAT---ATTATGACTTCGTGGTTATCCGATTATCTTGAAGATACCTGGAGTGAAGAGGGAACTAGCTTACTAAAATCTAACATTGAATTTAATTCAGATGATATAGATATTAGCACTGAAATGAGAAAATATTTTTGTGTAAAATCTTTT---
TRN  10010101110011000
NAM  Q91MP2_LSDV/6-196
ASQ  PKSGTETDYDESN-NFTAFAGSTIYGYGLKSKKNIK-KKVKLINFCIKISIMASMVSLITITILLAFFNNTCEL---NQFKEHKPYFLKNPNPTTYSDDDTESELNVYRSCKGIVYSGYCYTFNSEPKSFNDAYDDCEKKNSELPSNN-LMNDWISDYLDGTWGEDGNVLFKEKNQ-ELETIDISDEMRSYYCVRSFF
DSQ  CCAAAGAGTGGAACTGAAACAGATTATGATGAAAGTAAT---AATTTTACAGCATTCGCAGGTTCCACTATATACGGATATGGTTTAAAATCAAAAAAAAATATAAAA---AAAAAAGTAAAATTAATTAATTTCTGTATAAAAATATCAATTATGGCATCAATGGTTTCGTTAATTACAATAACAATTCTTTTAGCATTTTTTAATAATACATGTGAATTA---------AATCAATTTAAGGAACACAAACCGTACTTTTTAAAAAATCCAAATCCTACTACATATAGTGACGACGATACTGAATCTGAGTTAAATGTTTATAGATCATGTAAAGGTATTGTTTATAGCGGATACTGTTACACGTTTAACTCAGAACCTAAAAGTTTTAATGATGCATACGATGATTGTGAAAAAAAAAATAGCGAATTACCATCAAATAAT---TTAATGAATGATTGGATAAGTGACTACTTGGATGGGACGTGGGGGGAAGATGGTAACGTACTTTTTAAAGAAAAAAATCAA---GAACTTGAAACTATAGATATAAGCGACGAGATGAGAAGCTATTACTGTGTAAGATCTTTTTTT
TRN  10010101110011000
NAM  Q8V3H7_SWPV/1-185
ASQ  MSVEVNMENVKSEDNATSFSGSTIYGNKLKKKTN-K-SKSRCLAIGLRIAIITSLLSLIGIATTLALQYNKCKSVIEHNEQSYNNQDNITPDANYNIV-------KLYTGCQGIVYEYYCLRLVYEPLSFDDAVKSCMKNKGNLPSSD-LMKTWLSDYLDGTWGEEGRGLSKEKT---ILEVDISTELRSHFCLESFY
DSQ  ATGTCTGTAGAAGTAAATATGGAGAATGTGAAATCTGAAGATAACGCTACATCATTTTCGGGATCTACTATATACGGTAATAAATTAAAGAAAAAAACGAAT---AAA---TCTAAGTCCAGATGTTTAGCTATAGGATTAAGGATTGCGATCATTACATCTCTACTATCACTAATAGGTATAGCTACTACATTAGCGTTACAATATAATAAATGTAAATCGGTTATTGAACACAACGAACAGTCATACAATAATCAAGATAATATTACACCAGATGCCAATTATAATATTGTT---------------------AAACTGTATACAGGATGTCAAGGTATAGTTTACGAATATTATTGTCTTAGATTAGTATACGAACCGTTATCATTCGATGATGCTGTAAAGTCGTGTATGAAAAATAAAGGAAATCTTCCGTCATCCGAC---TTGATGAAAACATGGTTATCGGATTATTTAGATGGTACATGGGGTGAAGAAGGTAGAGGACTAAGTAAGGAAAAGACC---------ATACTTGAAGTTGATATTAGCACAGAATTACGTAGTCATTTTTGTTTAGAATCATTTTAT
TRN  10010101100011000
NAM  O57236_9POXV/1-185
ASQ  MMTPEN------DEEQTSVFSATVYRDKIQGK----NKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAAS-STHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLTTWLIDYVKDTWGSDGNPITKTTSDY--QDSDVSQEVRKYFCVKTMN
DSQ  ATGATGACACCAGAAAAC------------------GACGAAGAGCAGACATCTGTGTTCTCCGCTACTGTTTACAGAGACAAAATTCAGGGAAAG------------AATAAACGCAAACGCGTGATTGGTCTATGTATTAGAATATCTATGGTTATTTCACTACTATCTATGATTACCATGTCCGCGTTTCTCATAGTGCGCCTAAATCAATGCATGTCTGCTAACGAGGCTGCTATTACTGACGCCGCTGTTGCCGTTGCTGCTGCATCA---TCTACTCATAGAAAGGTTGCGTCTAGCACTACGCAATATGATCACAAAGAAAGCTGTAATGGTTTATATTACCAGGGTTCTTGTTATATATTACATTCAGACTACCAGTTATTCTCGGATGCTAAAGCAAATTGCACTGCGGAATCATCAACACTACCCAATAAATCCGATGTCTTGACTACCTGGCTCATTGATTATGTTAAGGATACATGGGGATCTGATGGTAATCCAATTACAAAAACTACATCCGATTAT------CAAGATTCTGATGTATCACAAGAAGTTAGAAAGTATTTTTGTGTTAAAACAATGAAC
TRN  10010101110011000
//