EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05942 - PaREP1)
FAM  PF05942
PID  PaREP1
DES  Archaeal PaREP1 protein
IPR  IPR010268
ANO  25
ALN  160
AID  0.384292
APH  ((((((((Q8ZX97_PYRAE/3-157:0.37719,(Q8ZUA9_PYRAE/4-158:0.34843,Q8ZYD7_PYRAE/3-157:0.37615):0.07869):0.23255,(Q8ZUE8_PYRAE/3-157:0.25753,Q8ZZE3_PYRAE/3-156:0.39967):0.15539):0.08841,((Q970N9_SULTO/21-175:0.33031,(Q974D4_SULTO/9-160:0.25399,(Q8ZZZ5_PYRAE/4-155:0.16031,Q8ZUB5_PYRAE/4-154:0.33904):0.12035):0.20152):0.16155,((Q96Z15_SULTO/13-163:0.26619,Q972P3_SULTO/4-154:0.45878):0.05120,Q8ZY27_PYRAE/4-155:0.31256):0.10910):0.11857):0.14812,(Q8ZUL7_PYRAE/3-141:0.60290,Q8ZYC2_PYRAE/6-159:0.37531):0.17923):0.38846,(((Q8ZSM7_PYRAE/5-156:0.09011,Q8ZYZ9_PYRAE/6-157:0.24604):0.09349,Q8ZZ61_PYRAE/6-155:0.17888):0.06838,Q8ZZ16_PYRAE/5-153:0.16494):0.28768):0.21722,Q96ZS9_SULTO/5-147:0.46498):0.28794,((Q96X99_SULTO/5-154:0.38849,Q973N5_SULTO/6-150:1.10980):0.21032,(Q96XD8_SULTO/5-147:0.26202,Q973K2_SULTO/11-156:0.45590):0.17897):0.08971):0.33983,Q8ZY22_PYRAE/6-147:0.43293,Q977D0_SULTO/5-148:0.27012);
ATP  ((((((((Q8ZX97_PYRAE/3-157,(Q8ZUA9_PYRAE/4-158,Q8ZYD7_PYRAE/3-157)),(Q8ZUE8_PYRAE/3-157,Q8ZZE3_PYRAE/3-156)),((Q970N9_SULTO/21-175,(Q974D4_SULTO/9-160,(Q8ZZZ5_PYRAE/4-155,Q8ZUB5_PYRAE/4-154))),((Q96Z15_SULTO/13-163,Q972P3_SULTO/4-154),Q8ZY27_PYRAE/4-155))),(Q8ZUL7_PYRAE/3-141,Q8ZYC2_PYRAE/6-159)),(((Q8ZSM7_PYRAE/5-156,Q8ZYZ9_PYRAE/6-157),Q8ZZ61_PYRAE/6-155),Q8ZZ16_PYRAE/5-153)),Q96ZS9_SULTO/5-147),((Q96X99_SULTO/5-154,Q973N5_SULTO/6-150),(Q96XD8_SULTO/5-147,Q973K2_SULTO/11-156))),Q8ZY22_PYRAE/6-147,Q977D0_SULTO/5-148);
ATL  12.7449
DNO  25
DLN  480
DID  0.470816
DPH  (((Q8ZY27_PYRAE/4-155:0.33988,(Q8ZUE8_PYRAE/3-157:0.17851,Q8ZZE3_PYRAE/3-156:0.36006):0.13619):0.06181,(((Q8ZUL7_PYRAE/3-141:0.44103,Q8ZYC2_PYRAE/6-159:0.32946):0.16712,((Q8ZX97_PYRAE/3-157:0.30711,Q8ZUA9_PYRAE/4-158:0.37283):0.02317,Q8ZYD7_PYRAE/3-157:0.40562):0.13689):0.05147,((Q8ZZ16_PYRAE/5-153:0.18592,(Q8ZZ61_PYRAE/6-155:0.19483,(Q8ZSM7_PYRAE/5-156:0.19449,Q8ZYZ9_PYRAE/6-157:0.19602):0.07199):0.09116):0.29961,((Q96ZS9_SULTO/5-147:0.32670,Q973N5_SULTO/6-150:0.68590):0.14730,((Q96X99_SULTO/5-154:0.42061,(Q96XD8_SULTO/5-147:0.31817,Q973K2_SULTO/11-156:0.30910):0.10067):0.08870,(Q8ZY22_PYRAE/6-147:0.38282,Q977D0_SULTO/5-148:0.30916):0.15027):0.12717):0.18189):0.14105):0.03322):0.11760,((Q8ZUB5_PYRAE/4-154:0.24936,Q8ZZZ5_PYRAE/4-155:0.26393):0.08357,Q974D4_SULTO/9-160:0.27800):0.13621,(Q970N9_SULTO/21-175:0.29461,(Q972P3_SULTO/4-154:0.30527,Q96Z15_SULTO/13-163:0.28109):0.08450):0.10096);
DTP  (((Q8ZY27_PYRAE/4-155,(Q8ZUE8_PYRAE/3-157,Q8ZZE3_PYRAE/3-156)),(((Q8ZUL7_PYRAE/3-141,Q8ZYC2_PYRAE/6-159),((Q8ZX97_PYRAE/3-157,Q8ZUA9_PYRAE/4-158),Q8ZYD7_PYRAE/3-157)),((Q8ZZ16_PYRAE/5-153,(Q8ZZ61_PYRAE/6-155,(Q8ZSM7_PYRAE/5-156,Q8ZYZ9_PYRAE/6-157))),((Q96ZS9_SULTO/5-147,Q973N5_SULTO/6-150),((Q96X99_SULTO/5-154,(Q96XD8_SULTO/5-147,Q973K2_SULTO/11-156)),(Q8ZY22_PYRAE/6-147,Q977D0_SULTO/5-148)))))),((Q8ZUB5_PYRAE/4-154,Q8ZZZ5_PYRAE/4-155),Q974D4_SULTO/9-160),(Q970N9_SULTO/21-175,(Q972P3_SULTO/4-154,Q96Z15_SULTO/13-163)));
DTL  10.463
RID  0.384292
RPH  ((((((((Q8ZX97_PYRAE/3-157:0.37719,(Q8ZUA9_PYRAE/4-158:0.34843,Q8ZYD7_PYRAE/3-157:0.37615):0.07869):0.23255,(Q8ZUE8_PYRAE/3-157:0.25753,Q8ZZE3_PYRAE/3-156:0.39967):0.15539):0.08841,((Q970N9_SULTO/21-175:0.33031,(Q974D4_SULTO/9-160:0.25399,(Q8ZZZ5_PYRAE/4-155:0.16031,Q8ZUB5_PYRAE/4-154:0.33904):0.12035):0.20152):0.16155,((Q96Z15_SULTO/13-163:0.26619,Q972P3_SULTO/4-154:0.45878):0.05120,Q8ZY27_PYRAE/4-155:0.31256):0.10910):0.11857):0.14812,(Q8ZUL7_PYRAE/3-141:0.60290,Q8ZYC2_PYRAE/6-159:0.37531):0.17923):0.38846,(((Q8ZSM7_PYRAE/5-156:0.09011,Q8ZYZ9_PYRAE/6-157:0.24604):0.09349,Q8ZZ61_PYRAE/6-155:0.17888):0.06838,Q8ZZ16_PYRAE/5-153:0.16494):0.28768):0.21722,Q96ZS9_SULTO/5-147:0.46498):0.28794,((Q96X99_SULTO/5-154:0.38849,Q973N5_SULTO/6-150:1.10980):0.21032,(Q96XD8_SULTO/5-147:0.26202,Q973K2_SULTO/11-156:0.45590):0.17897):0.08971):0.33983,Q8ZY22_PYRAE/6-147:0.43293,Q977D0_SULTO/5-148:0.27012);
RTP  ((((((((Q8ZX97_PYRAE/3-157,(Q8ZUA9_PYRAE/4-158,Q8ZYD7_PYRAE/3-157)),(Q8ZUE8_PYRAE/3-157,Q8ZZE3_PYRAE/3-156)),((Q970N9_SULTO/21-175,(Q974D4_SULTO/9-160,(Q8ZZZ5_PYRAE/4-155,Q8ZUB5_PYRAE/4-154))),((Q96Z15_SULTO/13-163,Q972P3_SULTO/4-154),Q8ZY27_PYRAE/4-155))),(Q8ZUL7_PYRAE/3-141,Q8ZYC2_PYRAE/6-159)),(((Q8ZSM7_PYRAE/5-156,Q8ZYZ9_PYRAE/6-157),Q8ZZ61_PYRAE/6-155),Q8ZZ16_PYRAE/5-153)),Q96ZS9_SULTO/5-147),((Q96X99_SULTO/5-154,Q973N5_SULTO/6-150),(Q96XD8_SULTO/5-147,Q973K2_SULTO/11-156))),Q8ZY22_PYRAE/6-147,Q977D0_SULTO/5-148);
RTL  12.7449
LNK  Q8ZSM7_PYRAE/5-156:Q8ZSM7:AE009945
LNK  Q8ZUA9_PYRAE/4-158:Q8ZUA9:AE009898
LNK  Q8ZUB5_PYRAE/4-154:Q8ZUB5:AE009897
LNK  Q8ZUE8_PYRAE/3-157:Q8ZUE8:AE009895
LNK  Q8ZUL7_PYRAE/3-141:Q8ZUL7:AE009891
LNK  Q8ZX97_PYRAE/3-157:Q8ZX97:AE009819
LNK  Q8ZY22_PYRAE/6-147:Q8ZY22:AE009797
LNK  Q8ZY27_PYRAE/4-155:Q8ZY27:AE009796
LNK  Q8ZYC2_PYRAE/6-159:Q8ZYC2:AE009789
LNK  Q8ZYD7_PYRAE/3-157:Q8ZYD7:AE009787
LNK  Q8ZYZ9_PYRAE/6-157:Q8ZYZ9:AE009771
LNK  Q8ZZ16_PYRAE/5-153:Q8ZZ16:AE009770
LNK  Q8ZZ61_PYRAE/6-155:Q8ZZ61:AE009766
LNK  Q8ZZE3_PYRAE/3-156:Q8ZZE3:AE009761
LNK  Q8ZZZ5_PYRAE/4-155:Q8ZZZ5:AE009746
LNK  Q96X99_SULTO/5-154:Q96X99:BA000023
LNK  Q96XD8_SULTO/5-147:Q96XD8:BA000023
LNK  Q96Z15_SULTO/13-163:Q96Z15:BA000023
LNK  Q96ZS9_SULTO/5-147:Q96ZS9:BA000023
LNK  Q970N9_SULTO/21-175:Q970N9:BA000023
LNK  Q972P3_SULTO/4-154:Q972P3:BA000023
LNK  Q973K2_SULTO/11-156:Q973K2:BA000023
LNK  Q973N5_SULTO/6-150:Q973N5:BA000023
LNK  Q974D4_SULTO/9-160:Q974D4:BA000023
LNK  Q977D0_SULTO/5-148:Q977D0:BA000023
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q977D0_SULTO/5-148
ASQ  LDY---KKNPKEYVYAKVYESLVEARLALEMLKRGLLKNASAKAFLSVKSAVSALLVSKLNEILK----------GKDEKERSWYENVGYSAPTTGLIGIAKEFKKLG-IDIENVVKTALLLHKFSYNGFDPNFV--DYRNEDEVADDIREVIEWVLNID
DSQ  TTAGATTAT---------AAAAAGAATCCTAAGGAATATGTTTATGCAAAGGTATATGAAAGCTTAGTTGAGGCCAGATTAGCTTTAGAGATGCTTAAAAGGGGTCTCCTAAAGAATGCATCAGCAAAAGCTTTTCTTTCTGTTAAATCTGCAGTAAGTGCTCTGTTAGTATCTAAGCTTAATGAGATTTTAAAA------------------------------GGAAAGGATGAAAAGGAGCGTTCATGGTATGAAAACGTTGGTTATTCTGCACCAACTACCGGACTTATAGGTATTGCAAAAGAATTTAAGAAGCTAGGT---ATTGATATTGAAAATGTCGTTAAGACTGCCCTCTTATTGCATAAGTTTTCTTATAACGGCTTCGATCCTAACTTCGTG------GATTATAGAAATGAGGATGAAGTAGCGGATGACATTAGAGAAGTGATAGAATGGGTCTTAAACATAGAT
TRN  10010101100011000
NAM  Q8ZY22_PYRAE/6-147
ASQ  DYKSRP----REYIVARFNEAAAEANLAEEMLRRELYQNAANKAFMALKALTSAIVASELCNLKR------------DEKRREWYEKVGYAAPTTGLIKIAKDLEALGYKGIEAAVKTALLLHRLAYNGFDPNFV--DYLDTDEVVSDIKQVLDFVKTTI
DSQ  GACTATAAGTCCAGACCC------------AGGGAGTATATAGTGGCTAGGTTTAATGAGGCAGCGGCTGAGGCTAATCTGGCTGAGGAGATGTTGAGACGAGAGCTTTATCAAAACGCGGCGAATAAGGCCTTTATGGCGTTGAAGGCTTTGACAAGCGCCATAGTGGCGTCTGAGCTTTGCAATTTAAAGAGG------------------------------------GACGAGAAGAGGCGGGAGTGGTATGAAAAAGTCGGCTACGCCGCGCCTACGACGGGCCTTATTAAAATAGCTAAAGACTTAGAGGCCTTAGGTTACAAGGGGATTGAGGCGGCTGTGAAGACGGCGTTGTTACTCCACCGCCTCGCCTACAACGGCTTTGATCCCAATTTTGTC------GACTATTTAGACACAGACGAAGTTGTATCCGACATAAAACAAGTCCTGGACTTCGTAAAAACCACAATA
TRN  10010101100011010
NAM  Q973K2_SULTO/11-156
ASQ  EGTVPQVKNLQSYINFKLEEAIVELNLAIELLKRGYSRNASQKAFMAWKAIVSVLVSMNLDKMP------------KDEKEREWYYKAGFLAPTTGLNGIARRLEELGYADVIGTNSLALKLHRYAYNGIYRG--TSDYADRKDAIEDLKILIRKMIRML
DSQ  GAGGGTACAGTACCTCAGGTTAAGAATCTTCAGAGTTATATTAATTTTAAGCTTGAAGAGGCAATTGTTGAACTTAATCTGGCAATAGAGTTACTCAAAAGGGGGTACAGTAGGAATGCGTCTCAAAAGGCATTTATGGCGTGGAAAGCAATAGTTAGCGTTTTAGTTTCGATGAATTTAGATAAAATGCCC------------------------------------AAGGATGAAAAGGAGAGGGAGTGGTATTATAAAGCCGGGTTTTTAGCTCCCACTACTGGGCTTAATGGAATAGCTAGGAGATTAGAGGAATTAGGTTACGCAGATGTTATAGGAACAAATTCTCTAGCACTAAAGCTTCATAGATATGCATATAACGGAATATACAGGGGG------ACTAGCGATTATGCAGATAGGAAGGACGCAATAGAGGACTTAAAAATCTTAATAAGAAAAATGATTAGAATGTTA
TRN  10010101100011010
NAM  Q96XD8_SULTO/5-147
ASQ  IPAIE--KHRNAYIKIRVIESLDELALALKLLKEGFSRNSASKIFLSWKALISALAVMNLEKMP------------RDEKEKEWYYKSGFLAPTTGLKGISQRLEELGY-KVNHLTSTALELHRYAYNGLYKGA--SDYSDREEAVRDILQLAKDILTNV
DSQ  ATACCAGCAATTGAG------AAGCACAGAAATGCTTACATAAAAATCAGAGTGATTGAAAGCTTAGATGAACTAGCCTTGGCTTTAAAACTCCTTAAAGAGGGATTCAGTAGGAACTCAGCAAGTAAGATTTTCCTTTCATGGAAGGCATTAATAAGCGCTTTAGCAGTCATGAACTTAGAAAAAATGCCC------------------------------------AGAGACGAAAAAGAAAAAGAGTGGTACTATAAATCTGGTTTCCTCGCTCCAACTACTGGATTGAAAGGAATATCACAAAGACTTGAAGAATTAGGGTAT---AAAGTGAATCATTTAACTTCTACTGCTCTTGAACTACATAGATATGCTTATAATGGATTATATAAAGGAGCA------AGTGACTACTCAGACAGAGAAGAGGCAGTAAGAGATATTCTTCAGTTAGCCAAAGATATTCTTACTAATGTA
TRN  10010101110011000
NAM  Q96X99_SULTO/5-154
ASQ  LPKFI--REPEKYSRLRLLESLQELYLSVEMLKAGYSRNSASKLFLSWKALLSSLVVANFNKIVE-----KKKKEGK-EDDVKWYLRIGYSAPTTGLMGISRDLEDLGFKGLVTLTTAMLGIHRYAYNGLDED--ISPFHSRNDAIISIKELVRAEVEII
DSQ  TTACCTAAATTTATC------AGAGAGCCAGAGAAGTATTCTAGGTTAAGGTTACTTGAATCCTTGCAAGAGCTCTATTTAAGTGTTGAGATGCTTAAGGCTGGTTATAGTAGGAATTCTGCGAGTAAGCTCTTTCTTTCATGGAAGGCTCTTTTAAGCTCACTCGTTGTTGCAAATTTTAACAAAATTGTGGAA---------------AAGAAGAAGAAGGAGGGGAAG---GAAGATGATGTTAAATGGTATTTAAGGATAGGATATTCTGCACCTACTACTGGTTTAATGGGAATTTCTAGAGATCTTGAAGACCTTGGGTTTAAGGGGTTAGTTACTTTAACAACTGCAATGCTAGGAATTCATAGGTATGCATATAATGGTTTAGATGAGGAT------ATAAGCCCCTTTCATAGTCGAAATGATGCGATAATATCAATAAAGGAGTTAGTGAGGGCTGAAGTTGAAATAATA
TRN  10010101110011000
NAM  Q974D4_SULTO/9-160
ASQ  LTK--PWIDMKKYQEDRLKEAWYEADLAERLMNDGLLRNAAGKAYQAVKAYVAAVAVNFRPQLAKYFPGKKKISPS---KEVEKVDWIIAIMPSSKLRKVVAII---GDDQLRLLTEIALDLHEFQYNGFDKDSEVSRYDSEEFVKKDILYIVNFIKSKV
DSQ  TTAACTAAA------CCTTGGATTGACATGAAGAAGTATCAAGAAGATAGGTTAAAAGAAGCTTGGTATGAGGCTGACTTAGCTGAGAGGCTAATGAATGACGGGCTTTTAAGGAATGCTGCAGGTAAAGCTTATCAGGCTGTAAAGGCTTATGTTGCTGCAGTTGCTGTAAACTTTAGACCTCAGCTGGCAAAGTATTTTCCAGGTAAGAAAAAGATTTCGCCATCT---------AAGGAGGTAGAGAAAGTTGACTGGATAATCGCTATAATGCCAAGCAGTAAGCTAAGGAAAGTAGTTGCAATAATA---------GGTGATGATCAACTAAGATTATTAACTGAAATAGCTCTTGACCTTCATGAGTTTCAATATAACGGTTTTGATAAAGACTCTGAGGTTTCAAGGTACGATAGCGAGGAATTCGTAAAGAAGGATATACTCTACATAGTGAATTTCATAAAAAGTAAGGTG
TRN  10010101100011000
NAM  Q8ZZZ5_PYRAE/4-155
ASQ  LSK--PWVDLEKYRRDRLKEALYEAELAEEFLKNGLIRNAAGKAFQAVKAYLAAVAAAHRDRIVAAFPGRRRISPA---KVVERGEWIIAVMPTSRMREVAAIV---GDRELRLMVELALDLHEFQYNGLDGDAEVSRYASEEMVRRDIEEVVAFIKRAA
DSQ  CTCTCCAAG------CCTTGGGTGGATTTAGAAAAGTACCGGCGAGACCGCTTAAAAGAGGCGTTGTACGAGGCCGAGCTGGCCGAGGAGTTTTTAAAAAACGGCCTCATCCGAAACGCCGCTGGTAAGGCGTTTCAAGCCGTCAAGGCCTATTTGGCGGCCGTCGCCGCGGCGCACAGAGATAGAATAGTGGCGGCTTTTCCGGGCAGGCGCAGGATTAGCCCCGCC---------AAAGTGGTAGAGAGGGGAGAGTGGATAATTGCCGTAATGCCCACATCGCGCATGCGGGAGGTGGCGGCTATCGTC---------GGCGATAGGGAGTTGAGGCTGATGGTGGAGCTGGCTCTGGACTTGCACGAGTTTCAATACAACGGCCTTGACGGCGACGCTGAGGTTTCTAGATACGCCAGCGAGGAAATGGTGAGGAGAGATATAGAGGAGGTGGTGGCTTTTATCAAAAGGGCGGCT
TRN  10010101100011010
NAM  Q8ZUB5_PYRAE/4-154
ASQ  LAK--PWHDVDKYRRDRLKEALYEAELAEEFLKNGLYKNAAGKAFQAVKAYLAAVAAEKREALAQYYPGERTVQK----KKVAVVDLLIAYMPTTRMKEVAARL---GDRELELVVEKALDLHQFQYNGLDREGVFSRYTTLEIVERDIKDVVEFVKRRV
DSQ  TTGGCTAAG------CCGTGGCATGATGTTGATAAGTATAGGAGGGATAGGCTGAAGGAGGCGTTATACGAGGCGGAGCTCGCCGAGGAATTTCTTAAAAACGGCCTGTATAAAAATGCGGCTGGCAAGGCGTTCCAAGCAGTAAAGGCATATTTAGCGGCTGTTGCTGCTGAAAAAAGAGAGGCATTGGCTCAGTATTATCCAGGCGAGAGGACTGTGCAGAAA------------AAGAAAGTGGCTGTAGTTGATCTCCTCATTGCATATATGCCAACCACAAGGATGAAGGAAGTGGCGGCGAGGCTC---------GGCGATAGGGAGCTAGAGCTTGTAGTTGAAAAGGCCTTAGATCTCCACCAGTTTCAATACAACGGGCTTGACAGAGAGGGGGTTTTTTCAAGATACACCACATTAGAAATAGTGGAGAGAGATATAAAAGACGTGGTAGAGTTCGTAAAAAGACGCGTT
TRN  10010101100011000
NAM  Q970N9_SULTO/21-175
ASQ  VTK--PWIDDKKYKQDRLIEAKYEAELARRFLEDGLFRNAAGKAFQAWKALLASLSVDYIQELSKYFKGKRKMRDGR---VVNYVEWIIALMPTSKMSNVAQILDNLLGNNIEAYTDIAIKLHEFQYNGLDKSGEISRYTSIEFVKMDLEKLLKAIEKFL
DSQ  GTAACAAAA------CCCTGGATTGATGATAAAAAGTACAAGCAAGATAGATTGATAGAGGCAAAATATGAGGCTGAACTTGCTAGAAGATTTTTAGAGGATGGATTATTTAGAAATGCTGCAGGTAAGGCTTTTCAAGCCTGGAAAGCTTTGTTAGCTTCACTTTCCGTTGATTATATACAAGAGCTTTCTAAGTATTTTAAGGGAAAGAGGAAAATGAGAGATGGAAGA---------GTAGTCAATTACGTTGAATGGATAATTGCATTAATGCCTACTAGTAAGATGAGTAACGTAGCTCAAATTCTTGATAACTTACTGGGAAATAATATAGAGGCTTACACTGATATTGCGATTAAACTTCATGAATTCCAATATAATGGGTTAGATAAAAGCGGTGAGATAAGCAGATATACATCAATAGAATTCGTAAAAATGGACTTAGAGAAACTTCTGAAGGCAATTGAAAAGTTTCTT
TRN  10010101100011000
NAM  Q8ZYD7_PYRAE/3-157
ASQ  IVY--PWRDIRRYVEIRISEALVEADLALRFLEEGLHRNAAGKAFQAWKAALAAAAGLARDVVASKFKGRVVTREG---AEVELADWLIALMPTGKMWEIARVLKGVYGDEITLLTAMALNLHEVQYNGLDEGGLLSKYSRVDQVEEDVRELAERVKKFV
DSQ  ATCGTATAC------CCTTGGAGAGATATAAGGAGGTATGTAGAGATCAGAATCTCCGAGGCGCTAGTTGAGGCCGACTTAGCTCTGCGGTTTCTTGAAGAGGGGTTGCACAGAAATGCGGCCGGCAAGGCTTTTCAAGCGTGGAAAGCCGCTTTAGCCGCGGCGGCAGGGCTGGCCAGAGATGTGGTTGCGTCTAAGTTTAAGGGACGTGTTGTTACGCGCGAGGGG---------GCAGAGGTGGAACTGGCCGACTGGCTTATTGCGTTAATGCCCACTGGGAAAATGTGGGAGATCGCCCGCGTATTAAAAGGCGTATATGGCGACGAAATTACATTGCTGACGGCGATGGCATTAAATCTACACGAAGTGCAATACAACGGGCTGGATGAGGGCGGCCTATTGAGTAAGTATTCGCGTGTGGATCAAGTGGAGGAAGACGTAAGAGAGCTCGCCGAAAGGGTTAAAAAATTCGTG
TRN  10010101100011010
NAM  Q8ZUA9_PYRAE/4-158
ASQ  FVP--PWRDLEGYVQLRLEEASAEAELALKFLAQGLHRNAAGKAFQGWKALLAAAAAKNREVLTSRYPGVIRDKTH---KARSRADIIIALMPTTKMREVAGLLVGIYGWELVYLTDLALSLHEFQYNGLDAVGIASRYSHISDVERDIRHLSEKIKEWA
DSQ  TTCGTCCCT------CCCTGGAGGGATCTCGAAGGCTACGTCCAGTTGAGGCTTGAGGAGGCTAGCGCCGAGGCGGAGTTAGCCTTGAAGTTCTTGGCCCAGGGCCTTCACAGAAACGCGGCTGGAAAGGCCTTTCAGGGGTGGAAGGCCCTTTTGGCAGCCGCGGCGGCTAAAAACAGGGAGGTTTTAACAAGCCGCTATCCTGGCGTCATAAGGGATAAGACTCAC---------AAGGCGAGATCCAGGGCTGATATAATCATTGCGTTAATGCCAACTACTAAAATGAGAGAGGTTGCTGGACTACTGGTAGGAATATATGGCTGGGAGTTGGTCTACCTCACCGATCTCGCTCTGAGTCTGCACGAATTTCAATACAACGGATTAGACGCCGTGGGCATTGCCAGCAGATACTCCCATATCAGCGATGTGGAGAGGGATATCCGCCACCTCTCCGAAAAAATAAAGGAGTGGGCG
TRN  10010101100011010
NAM  Q8ZX97_PYRAE/3-157
ASQ  VVH--PWRDLRKYVEIRLEEAEAELRLAERFLEEGLYRNAAGKAFQAWKSLMAAIGAMYRDVLAKHFPGVVKTRDG---KTVPRVDWVLAYMPTTRLREVAIRLRGVAEFDIVSLTDLALNLHEFQYNGVDKEAVLSRYTALDLAVSDLNYFIEKCKEVL
DSQ  GTCGTACAC------CCCTGGAGAGATCTGCGTAAATACGTAGAGATTAGGCTTGAGGAGGCAGAGGCCGAGCTGAGACTCGCTGAGAGGTTTCTAGAGGAAGGGCTTTATAGAAACGCGGCTGGAAAAGCCTTTCAAGCCTGGAAGTCCTTAATGGCGGCAATAGGCGCCATGTACAGAGATGTCCTGGCCAAGCACTTCCCAGGGGTTGTAAAAACGCGAGATGGC---------AAAACTGTGCCTAGAGTGGACTGGGTGCTGGCCTACATGCCCACTACGAGGCTAAGGGAAGTGGCTATAAGGCTAAGAGGCGTGGCGGAATTTGACATAGTCTCGCTCACAGACTTAGCCCTTAATCTCCACGAGTTTCAATACAACGGCGTCGATAAAGAAGCGGTGTTGAGCAGATACACTGCGCTGGACTTAGCAGTTTCCGATTTAAATTACTTCATAGAAAAATGTAAAGAGGTGTTA
TRN  10010101100011010
NAM  Q972P3_SULTO/4-154
ASQ  LPK--PWFDIEGYKRTRIKEAEFEANIAEEFVKEGLLRNAAGKAFQAWKALLGAMLVDIRGELLKKYPGKKKLRGR---KIVEFADWLIAIIPTSYMEELSLLL---G-KDVNLVTKLALALHEYQYNGADKDTILSPFRTDDIAKENILILIDEIRSRL
DSQ  TTGCCGAAA------CCTTGGTTTGATATTGAAGGTTATAAGAGAACTAGGATAAAGGAAGCGGAATTTGAGGCTAATATAGCTGAAGAGTTTGTAAAAGAAGGGCTTTTACGCAATGCTGCGGGTAAAGCATTTCAAGCATGGAAAGCTCTATTAGGTGCTATGCTGGTAGATATAAGGGGCGAGTTATTAAAGAAATATCCTGGCAAGAAGAAATTGAGAGGGAGG---------AAAATAGTAGAGTTTGCGGATTGGTTAATTGCTATTATACCTACTTCCTATATGGAGGAGCTATCCCTCCTTTTA---------GGA---AAAGATGTAAACTTAGTTACCAAATTAGCCTTAGCACTTCATGAATATCAGTATAATGGGGCAGATAAAGACACTATACTAAGCCCATTCAGAACTGATGATATCGCAAAAGAAAATATACTTATTTTGATAGATGAAATAAGATCAAGACTA
TRN  10010101100011000
NAM  Q96Z15_SULTO/13-163
ASQ  LPK--PWFDLQAYKKTRLLEAKYEAEIARKFLDEGLIRNAAGKTYQAWKALVAGIAVDHRDKLKGLFTGKIKIKGG---KMIEKVDWVIAIMPSTALKIVSQVI---GG-EISLYTNLALLIHQYQYNGPDKEGIVSPYTNDEIAKNDIILLLNEIEKIL
DSQ  CTACCGAAG------CCTTGGTTTGATCTTCAAGCTTATAAGAAGACAAGACTCTTAGAGGCTAAATATGAAGCGGAGATTGCAAGAAAATTCCTTGATGAAGGCCTAATTAGGAATGCAGCAGGGAAAACTTATCAGGCTTGGAAAGCTTTAGTTGCAGGTATTGCCGTAGATCATAGGGATAAGTTGAAGGGTTTGTTTACGGGTAAAATTAAAATAAAAGGTGGG---------AAAATGATAGAGAAAGTCGATTGGGTTATCGCTATAATGCCCAGTACTGCATTAAAAATAGTCTCACAAGTTATC---------GGGGGT---GAAATCTCGCTTTATACTAATTTAGCTTTACTTATTCATCAATATCAGTATAATGGCCCAGATAAGGAGGGTATCGTAAGTCCTTACACAAATGATGAAATAGCCAAGAACGACATTATTTTGCTTCTTAACGAAATAGAGAAAATCTTA
TRN  10010101110011000
NAM  Q8ZY27_PYRAE/4-155
ASQ  LPK--PWFDLRRYKEVRLREAVYEAEISEEFLEEGLVRNAAGKAFQSWKAVVAAHSVDKLEELKKAFPGRKRLRGSR--RVVEKAMWVIAIMPTSALKKVAQII---GG-EVDLYTNLALLLHEYQYNGPDPEGILSIYPDDDSAAKDVRKLIEKARQLA
DSQ  TTGCCTAAG------CCCTGGTTTGACTTAAGGCGGTATAAAGAGGTTAGGCTGCGAGAGGCGGTATACGAGGCCGAGATCTCAGAGGAGTTCTTAGAGGAGGGGCTTGTGCGCAACGCGGCAGGCAAGGCCTTTCAGAGCTGGAAGGCGGTGGTGGCGGCGCACTCTGTAGACAAGCTCGAGGAGTTGAAAAAGGCGTTTCCAGGCCGTAAGAGGTTAAGGGGCTCAAGG------CGAGTAGTAGAGAAGGCGATGTGGGTCATCGCAATTATGCCGACATCGGCGCTTAAAAAAGTAGCGCAGATAATA---------GGGGGG---GAGGTAGACCTCTACACAAATCTAGCCTTACTCCTCCACGAATATCAGTACAATGGGCCTGATCCAGAGGGAATACTCTCCATATACCCTGACGATGACTCCGCTGCCAAAGACGTGAGAAAGCTAATAGAAAAGGCAAGACAGCTAGCA
TRN  10010101100011000
NAM  Q8ZZE3_PYRAE/3-156
ASQ  LAK--PWSDLNGYIEARRKETLFEAELAREFLRQGLTRNAAGKAYQAWKATIAVLAAKKLGYLSSVYRWVKRIKN----KRVGMAEWHVAYMPSTRLREVARLLAEAYGIEVFLATELALSLHEYQFNGPDKELVLSRYKSDDEAARDVELLLKYVEVFL
DSQ  CTGGCAAAG------CCTTGGTCTGACTTAAACGGCTACATAGAGGCCAGGCGGAAAGAGACCTTGTTTGAGGCAGAGCTAGCCCGGGAGTTTTTAAGACAAGGATTGACGCGCAACGCCGCCGGCAAGGCTTATCAAGCTTGGAAGGCAACAATCGCAGTCTTGGCGGCGAAGAAACTGGGCTATTTGTCCTCTGTGTACAGGTGGGTGAAGCGTATTAAAAAC------------AAAAGAGTGGGTATGGCTGAGTGGCATGTGGCATATATGCCGTCGACAAGGCTGAGAGAGGTTGCTAGGCTGTTGGCAGAGGCGTACGGAATAGAGGTGTTTTTAGCGACAGAACTCGCGCTATCTCTTCACGAGTACCAGTTCAACGGCCCCGACAAAGAGCTCGTGTTGAGCAGATACAAGTCAGACGACGAGGCCGCCAGAGACGTGGAGCTCTTGCTTAAATACGTGGAGGTGTTTCTA
TRN  10010101100011000
NAM  Q8ZUE8_PYRAE/3-157
ASQ  LEK--PWRDEIGYLKARLLEAKYEAELAKGFLEQGLYRNAAGKAYQAWKALLAALALREREALKNVFKDVKRLRNG---KRLSEADWVVAFMPSTRIRHVAQILARKYGDELLMYTDVALNLHEYQYNGPDKEGIFSRYFNDDAAREDVERLLKGVEKFR
DSQ  CTGGAGAAG------CCTTGGAGGGACGAAATTGGCTACTTAAAGGCCAGACTGTTGGAGGCTAAGTACGAGGCGGAGCTGGCTAAGGGTTTTTTAGAACAAGGGCTTTACAGAAACGCGGCCGGCAAGGCCTATCAAGCTTGGAAGGCTTTGTTGGCGGCTTTGGCGTTGAGGGAAAGGGAAGCGTTAAAAAATGTGTTTAAAGACGTGAAGAGGTTGCGAAACGGC---------AAGAGGCTGAGCGAGGCGGACTGGGTAGTGGCCTTTATGCCCTCTACTCGCATTAGACACGTGGCGCAAATACTGGCGAGAAAATACGGGGATGAGCTGTTGATGTATACAGACGTTGCCCTAAACCTTCACGAGTATCAGTACAACGGCCCGGACAAAGAGGGCATATTTAGCAGATATTTTAATGACGACGCCGCTAGAGAGGACGTGGAGAGGCTGTTAAAAGGCGTGGAGAAATTCAGA
TRN  10010101100011010
NAM  Q8ZYC2_PYRAE/6-159
ASQ  LSK--PWRDLEKYREARLREARVEIDLALEFLEDGLIRIAAGKAFQAWKAYLASRLAEKREALKELFPGSRRIRAGEEEIEVEDVDVVIALVPTTQMIKLSTVV---GE-DAVEFTSLALDLHRYQYNGPDPEGFFSEVPDDRTAALLICRMAFRLAGDT
DSQ  TTGAGCAAG------CCTTGGAGAGACTTGGAGAAATATAGGGAGGCTAGGTTGCGGGAGGCGCGGGTTGAGATAGACCTCGCGCTTGAGTTTCTAGAGGACGGCCTTATTAGAATTGCCGCCGGTAAGGCCTTTCAAGCTTGGAAGGCTTACCTCGCCTCTCGTCTAGCTGAGAAGAGAGAGGCGTTAAAGGAGCTTTTCCCCGGCTCTAGGAGAATTAGGGCAGGGGAAGAGGAAATAGAAGTGGAAGATGTAGACGTTGTTATCGCCCTGGTGCCGACTACTCAAATGATTAAATTATCAACTGTAGTT---------GGCGAG---GACGCAGTTGAATTCACATCCTTAGCGCTTGATCTTCACCGTTATCAATACAACGGCCCCGATCCCGAGGGCTTTTTCTCCGAGGTGCCAGACGACAGGACGGCCGCCCTCCTTATCTGCCGCATGGCTTTTAGACTGGCAGGCGATACA
TRN  10010101100011000
NAM  Q8ZUL7_PYRAE/3-141
ASQ  VVVEKPWRNLQEYIKARLEEAAVELQLALILMGEGYTRNAAGKLFQAFKSYLAAAAGEKREELAARLRD---------------VDKLIAYMPTRALVKISTLL------GLEREARVALALRQYQYNGPDPEGITSLYPDRESAKRDFCWLAKRLIELT
DSQ  GTGGTAGTAGAAAAGCCCTGGAGGAATTTACAGGAGTACATTAAGGCGAGGCTTGAAGAGGCTGCTGTCGAGCTACAGCTGGCCTTAATTTTAATGGGGGAAGGCTATACGAGAAACGCCGCCGGGAAGTTATTTCAAGCGTTCAAGTCCTATTTGGCCGCGGCTGCCGGCGAGAAGAGGGAGGAACTCGCCGCCCGCCTAAGAGAT---------------------------------------------GTGGACAAGTTAATTGCCTATATGCCAACGAGGGCTTTGGTAAAAATTTCAACGCTTTTA------------------GGCCTTGAGAGAGAGGCCCGCGTGGCCCTAGCCTTACGCCAATATCAATACAACGGGCCAGACCCCGAGGGGATAACGTCGTTATACCCAGACAGAGAATCCGCCAAACGCGACTTCTGCTGGCTTGCCAAAAGGCTGATAGAGCTAACC
TRN  10010101100011000
NAM  Q96ZS9_SULTO/5-147
ASQ  LYKV-----DEDYVEARVIECLSDLLLSIALWKDGYTRNSAGKAFSAVKALLSALIVVNEEKLLSLAKDDKER---------EWIKKKAHTVPTHSMYALAQMLKEIG-IDVIQLVNYALDLHEYQYNGFEPG--FSKYSRKEDVLKDLTTVIKETEKAV
DSQ  CTTTATAAAGTG---------------GATGAGGATTATGTTGAAGCAAGAGTAATTGAGTGTTTATCAGACCTTTTACTCTCTATTGCTTTATGGAAGGACGGGTATACTAGGAACTCAGCTGGAAAAGCTTTTAGTGCAGTAAAAGCACTACTTAGCGCGTTAATTGTAGTTAACGAGGAAAAATTGCTGAGTCTAGCTAAGGACGATAAAGAGAGG---------------------------GAATGGATAAAGAAAAAGGCTCACACAGTCCCCACACATAGTATGTATGCTTTAGCTCAGATGTTGAAAGAAATTGGC---ATTGATGTAATACAATTAGTTAACTACGCTTTAGACTTACATGAATATCAATATAACGGCTTTGAACCTGGA------TTCAGTAAATACAGTAGAAAGGAAGATGTGTTGAAGGATTTAACCACTGTTATTAAAGAGACAGAAAAAGCTGTA
TRN  10010101100011000
NAM  Q8ZZ61_PYRAE/6-155
ASQ  RPL--PKPSSVDYASARVLEALVEGRLAVEFLERGLVRNAAGKAFQAWRALLAALLRLELDKLMNIAKTEEERRW--------LAERAVPRVPTTKMVSLSYMLEEAGHWGLSAWTALALDLHDYQYHGPDPDMALSKYRSKEEAAQAVLKLVTEIAKRA
DSQ  AGGCCGCTT------CCCAAGCCCTCCAGCGTGGATTACGCCTCTGCCCGCGTTTTAGAGGCTCTCGTGGAGGGGCGTCTGGCCGTGGAGTTTCTTGAAAGAGGCCTAGTGAGAAACGCGGCGGGCAAGGCCTTTCAGGCTTGGAGGGCTCTGCTGGCGGCTTTGCTGAGGCTGGAGCTGGACAAGTTGATGAATATCGCCAAGACTGAAGAAGAAAGGCGCTGG------------------------CTTGCGGAGAGGGCAGTGCCGAGAGTGCCCACCACTAAAATGGTGTCTCTATCGTACATGCTGGAAGAGGCTGGCCACTGGGGGCTATCCGCGTGGACCGCCTTGGCGTTAGATCTCCACGACTACCAATACCACGGCCCAGATCCCGACATGGCCCTTTCAAAATATAGGAGCAAGGAAGAGGCCGCCCAGGCTGTTTTAAAGCTAGTCACAGAAATAGCCAAAAGGGCC
TRN  10010101100011000
NAM  Q8ZZ16_PYRAE/5-153
ASQ  LERPLPKPSSEDYATARLLEALVEARLALEFLSRGLVRNAAGKAFQAWRALLAALLRLELDKLLKAAKTDEERKW-----------LVERAVPTTRMKLLSQMLEGVGHVGIVAWTNTALLLHEYQYHGPDPDLAASMYRNKEEAARDVELLVAELARRA
DSQ  CTCGAGCGCCCCCTCCCGAAGCCCTCCAGCGAGGACTACGCAACGGCTAGACTTCTTGAGGCGTTAGTAGAGGCGAGGCTCGCCCTGGAATTTCTCAGCCGCGGCCTAGTGAGAAACGCCGCTGGTAAGGCCTTTCAAGCTTGGAGGGCTCTGCTGGCGGCATTGCTTAGGCTGGAGCTTGACAAGTTGTTAAAAGCGGCGAAGACCGACGAGGAGAGGAAGTGG---------------------------------CTTGTGGAGAGGGCCGTGCCTACTACGAGGATGAAATTGCTGTCGCAAATGCTGGAGGGAGTTGGCCACGTGGGTATAGTCGCGTGGACAAACACGGCGTTGTTGTTGCACGAGTATCAATACCACGGGCCTGATCCAGACCTCGCGGCAAGCATGTACCGCAATAAAGAAGAGGCGGCGAGAGACGTAGAGCTACTGGTGGCAGAGCTGGCGAGGCGCGCC
TRN  10010101100011010
NAM  Q8ZYZ9_PYRAE/6-157
ASQ  LEKPLPKPSDEGYVSARLLEALAEGGLALRFLKEGLVRNAAGKAFQAWRALVAALLRLELDRLKAVVKSDEERKW--------LETTAVPRVPTSRIKALSQMLEAIGYDDVSLWTALSLNLHDYQYHGPDPDMAMSKYSSRVEAAYDVVKLVGGVVKYA
DSQ  TTAGAAAAGCCGCTCCCCAAGCCCTCGGATGAGGGCTATGTCTCAGCTAGGCTTTTAGAGGCCCTCGCGGAGGGCGGATTGGCGTTGCGATTTCTCAAAGAGGGCCTCGTGAGAAACGCCGCCGGCAAGGCCTTTCAGGCTTGGAGGGCGTTGGTGGCGGCTCTGCTACGCCTGGAGCTGGATAGGCTGAAGGCCGTTGTGAAAAGCGACGAGGAGAGGAAGTGG------------------------CTCGAGACAACTGCTGTGCCCAGAGTGCCCACAAGCAGAATAAAGGCGCTTTCCCAAATGCTCGAGGCAATTGGCTACGACGACGTGTCTCTGTGGACAGCCCTATCATTAAATCTCCACGACTATCAATACCACGGCCCGGATCCCGACATGGCCATGTCAAAATACAGCAGTAGGGTGGAGGCCGCTTACGACGTGGTCAAGCTAGTGGGAGGCGTTGTTAAATACGCC
TRN  10010101100011000
NAM  Q8ZSM7_PYRAE/5-156
ASQ  LEKPLPKPSTEGYVSARLLEALVEGRLALEFLERGLVRNAAGKAFQAWRAFLAALLRLELEKLKAVVKTEDERRW--------LESTAVPRVPTGRIKALSQMLEEVGHGGISFGTDKALDLHDYQYHGPDPDMALSKYRNREEAARDVVLLLKELAKRV
DSQ  CTTGAAAAACCCCTTCCCAAGCCGTCGACTGAGGGCTATGTCTCTGCGCGTTTGTTAGAGGCTCTGGTGGAGGGGCGTCTTGCTTTGGAGTTTCTTGAGAGGGGGCTTGTGAGAAACGCCGCTGGGAAGGCTTTTCAAGCATGGCGGGCGTTTTTGGCGGCTCTCCTCCGGTTGGAGTTAGAAAAACTTAAGGCCGTTGTAAAGACTGAGGATGAGAGGCGCTGG------------------------CTTGAATCCACAGCAGTGCCGAGAGTTCCCACTGGGAGAATAAAGGCGTTGTCACAAATGTTGGAGGAGGTGGGACATGGGGGCATTTCTTTCGGCACTGACAAGGCGCTTGATCTCCACGACTATCAATACCACGGCCCAGACCCGGACATGGCGTTGAGCAAATACCGCAACAGAGAGGAGGCGGCTAGAGACGTCGTGTTGCTTCTGAAAGAACTGGCTAAGCGCGTT
TRN  10010101100011000
NAM  Q973N5_SULTO/6-150
ASQ  VWE----RDIRKYGELRVEESIDEALIAIELLRQGKFRNSAVRAFLAFKAFVSGIISINHLSFSSNLEEKER----------KFFYKIGFTAPSNRLLYYASILEK-DLPGITDLAKQAMSLHVFSYVGYDRAGEYSPITSKEDAKKWILDFIIALANFI
DSQ  GTTTGGGAA------------AGAGATATTAGAAAATATGGAGAATTAAGAGTAGAGGAAAGTATTGATGAGGCTTTGATAGCTATAGAACTGCTAAGACAAGGTAAGTTCCGAAATTCTGCAGTGAGAGCATTTTTAGCATTTAAGGCGTTCGTAAGTGGAATTATAAGTATTAATCATCTATCTTTTTCCTCTAACTTAGAAGAAAAAGAAAGA------------------------------AAATTTTTCTATAAAATAGGCTTCACTGCTCCTTCAAATAGATTACTCTATTATGCATCTATTCTGGAGAAG---GACTTGCCTGGTATTACAGATTTAGCTAAACAAGCTATGTCTCTTCACGTCTTTTCATATGTCGGTTATGATAGAGCTGGAGAATATTCTCCAATAACTTCAAAAGAGGATGCAAAGAAATGGATACTGGATTTCATTATAGCTCTAGCTAACTTTATT
TRN  10010101100011000
//