EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05940 - NnrS)
FAM  PF05940
PID  NnrS
DES  NnrS protein
IPR  IPR010266
ANO  14
ALN  397
AID  0.340292
APH  ((Q8DBN2_VIBVU/5-376:0.13410,Q9KPN6_VIBCH/33-409:0.15089):0.60230,Q8EDE7_SHEON/13-385:0.53902,(((((Q8U7P5_AGRT5/3-388:1.21481,Q92Z46_RHIME/1-365:1.24131):0.24624,((Q8YBD6_BRUME/30-409:0.27010,(Q8U7R6_AGRT5/41-420:0.24812,Q92Z28_RHIME/21-400:0.21686):0.13331):0.27682,(Q936J2_RHOSH/11-390:0.51393,Q93SI1_BRAJA/11-390:0.46609):0.11470):0.18863):0.14833,Q8XTZ6_RALSO/23-398:0.67335):0.10789,Q9JT11_NEIMA/21-395:0.96455):0.13764,(P95556_PSEST/12-391:0.34894,Q9I0H6_PSEAE/12-392:0.26260):0.42598):0.12957);
ATP  ((Q8DBN2_VIBVU/5-376,Q9KPN6_VIBCH/33-409),Q8EDE7_SHEON/13-385,(((((Q8U7P5_AGRT5/3-388,Q92Z46_RHIME/1-365),((Q8YBD6_BRUME/30-409,(Q8U7R6_AGRT5/41-420,Q92Z28_RHIME/21-400)),(Q936J2_RHOSH/11-390,Q93SI1_BRAJA/11-390))),Q8XTZ6_RALSO/23-398),Q9JT11_NEIMA/21-395),(P95556_PSEST/12-391,Q9I0H6_PSEAE/12-392)));
ATL  9.75608
DNO  14
DLN  1191
DID  0.460896
DPH  ((((((Q8XTZ6_RALSO/23-398:0.37866,(((Q8YBD6_BRUME/30-409:0.27930,(Q8U7R6_AGRT5/41-420:0.24486,Q92Z28_RHIME/21-400:0.22009):0.09475):0.15428,(Q936J2_RHOSH/11-390:0.34792,Q93SI1_BRAJA/11-390:0.29274):0.05703):0.09952,Q8U7P5_AGRT5/3-388:0.76656):0.05234):0.12032,(P95556_PSEST/12-391:0.26486,Q9I0H6_PSEAE/12-392:0.22375):0.21203):0.05272,Q92Z46_RHIME/1-365:0.74018):0.06321,Q9JT11_NEIMA/21-395:0.56097):0.13172,Q8EDE7_SHEON/13-385:0.48687):0.34243,Q8DBN2_VIBVU/5-376:0.18845,Q9KPN6_VIBCH/33-409:0.18523);
DTP  ((((((Q8XTZ6_RALSO/23-398,(((Q8YBD6_BRUME/30-409,(Q8U7R6_AGRT5/41-420,Q92Z28_RHIME/21-400)),(Q936J2_RHOSH/11-390,Q93SI1_BRAJA/11-390)),Q8U7P5_AGRT5/3-388)),(P95556_PSEST/12-391,Q9I0H6_PSEAE/12-392)),Q92Z46_RHIME/1-365),Q9JT11_NEIMA/21-395),Q8EDE7_SHEON/13-385),Q8DBN2_VIBVU/5-376,Q9KPN6_VIBCH/33-409);
DTL  6.56891
RID  0.340292
RPH  ((Q8DBN2_VIBVU/5-376:0.13410,Q9KPN6_VIBCH/33-409:0.15089):0.60230,Q8EDE7_SHEON/13-385:0.53902,(((((Q8U7P5_AGRT5/3-388:1.21481,Q92Z46_RHIME/1-365:1.24131):0.24624,((Q8YBD6_BRUME/30-409:0.27010,(Q8U7R6_AGRT5/41-420:0.24812,Q92Z28_RHIME/21-400:0.21686):0.13331):0.27682,(Q936J2_RHOSH/11-390:0.51393,Q93SI1_BRAJA/11-390:0.46609):0.11470):0.18863):0.14833,Q8XTZ6_RALSO/23-398:0.67335):0.10789,Q9JT11_NEIMA/21-395:0.96455):0.13764,(P95556_PSEST/12-391:0.34894,Q9I0H6_PSEAE/12-392:0.26260):0.42598):0.12957);
RTP  ((Q8DBN2_VIBVU/5-376,Q9KPN6_VIBCH/33-409),Q8EDE7_SHEON/13-385,(((((Q8U7P5_AGRT5/3-388,Q92Z46_RHIME/1-365),((Q8YBD6_BRUME/30-409,(Q8U7R6_AGRT5/41-420,Q92Z28_RHIME/21-400)),(Q936J2_RHOSH/11-390,Q93SI1_BRAJA/11-390))),Q8XTZ6_RALSO/23-398),Q9JT11_NEIMA/21-395),(P95556_PSEST/12-391,Q9I0H6_PSEAE/12-392)));
RTL  9.75608
LNK  P95556_PSEST/12-391:P95556:Z73914
LNK  Q8DBN2_VIBVU/5-376:Q8DBN2:AE016802
LNK  Q8EDE7_SHEON/13-385:Q8EDE7:AE015719
LNK  Q8U7P5_AGRT5/3-388:Q8U7P5:AE009368
LNK  Q8U7R6_AGRT5/41-420:Q8U7R6:AE009367
LNK  Q8XTZ6_RALSO/23-398:Q8XTZ6:AL646075
LNK  Q8YBD6_BRUME/30-409:Q8YBD6:AE009729
LNK  Q92Z28_RHIME/21-400:Q92Z28:AE007256
LNK  Q92Z46_RHIME/1-365:Q92Z46:AE007254
LNK  Q936J2_RHOSH/11-390:Q936J2:U62403
LNK  Q93SI1_BRAJA/11-390:Q93SI1:AJ311165
LNK  Q9I0H6_PSEAE/12-392:Q9I0H6:AE004695
LNK  Q9JT11_NEIMA/21-395:Q9JT11:AL162758
LNK  Q9KPN6_VIBCH/33-409:Q9KPN6:AE004303
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KPN6_VIBCH/33-409
ASQ  IPAVLRLGFRPFFLLGSIYAVIAILAWVWMFQAGQPQL--LQVPALWWHVHEMLFGFAMAIVAGFLLTAVQNWTG.ITGTKSHRLAGIVALWLMVRILFWLPV--PLWLTSSIEALFLLAVAYEVGLRVVKAKGWRNLFFIPLFLLAIAANFASYA-TIKGMPPFPSSAvWQAMLWWFMLLLSVMGGRVIPFFTARRFQFTKA----EPILALDVIANGSLLALFVLSFFPLT---MAQLGQPLMLVAGVAQLIRFLRWQPWRTFSEPLVWSLHAAYLCIPLSLLLRGG----VSNAWLNHNLLHLFAIGALSGLVLSMIARVTMGHTGRAIYQGP.NMQWAFIAL-LLAAVVRGVGVGLLP-QQLLIWVNLSAALWVIAFALFVLRFGAMLLKPRV
DSQ  ATTCCTGCTGTGCTGCGGTTGGGGTTTCGTCCTTTCTTTTTGCTTGGCAGTATTTATGCCGTGATTGCCATCCTCGCGTGGGTTTGGATGTTTCAAGCTGGGCAACCGCAACTA------TTGCAAGTCCCCGCGCTATGGTGGCATGTGCATGAGATGTTGTTTGGTTTTGCAATGGCGATTGTGGCCGGATTTCTGCTTACGGCGGTGCAAAACTGGACGGGT...ATTACTGGCACGAAAAGTCACCGTTTAGCTGGTATTGTGGCTTTGTGGCTAATGGTGCGGATTCTGTTTTGGTTGCCCGTG------CCGCTGTGGTTAACGTCGAGTATTGAAGCTCTATTTCTTCTGGCGGTGGCCTATGAAGTGGGGTTACGGGTGGTAAAAGCCAAAGGTTGGCGCAACCTATTTTTTATCCCTCTGTTTCTGTTGGCGATTGCCGCTAACTTTGCCAGCTACGCC---ACCATTAAAGGCATGCCGCCATTCCCGAGCAGTGCGgtgTGGCAAGCCATGCTGTGGTGGTTTATGTTGCTGCTTTCAGTGATGGGCGGGCGAGTGATTCCGTTTTTCACCGCAAGACGTTTCCAGTTTACAAAAGCG------------GAGCCGATTTTGGCTTTGGATGTGATCGCTAACGGTAGCTTACTGGCGCTGTTTGTACTTAGTTTCTTCCCATTGACC---------ATGGCACAACTCGGCCAGCCTTTGATGCTGGTAGCTGGCGTCGCGCAATTGATCCGCTTTTTACGTTGGCAGCCTTGGCGTACTTTCAGTGAGCCTTTGGTGTGGTCACTGCATGCTGCCTATCTGTGTATCCCGCTGAGTTTGCTGCTGCGTGGGGGA------------GTGAGTAACGCTTGGCTGAACCACAACTTACTGCATTTATTTGCGATAGGTGCGCTCTCAGGCCTAGTTTTAAGCATGATTGCGCGTGTCACTATGGGGCATACGGGACGAGCGATTTATCAAGGCCCT...AACATGCAATGGGCATTTATCGCTTTG---TTGCTTGCCGCTGTCGTGCGTGGTGTCGGTGTGGGTTTGCTACCG---CAGCAGCTGCTGATTTGGGTGAACCTGAGCGCCGCGCTGTGGGTTATTGCGTTTGCTCTGTTTGTGCTGCGCTTTGGCGCAATGTTGCTGAAACCAAGAGTG
TRN  10010101100011000
NAM  Q8DBN2_VIBVU/5-376
ASQ  IPAWLRLGFRPFFLLGSVYAIIAIAVWVWIFQTGQPTQ--LQVPGLWWHVHEMLFGFAMAIVAGFLLTAVQNWTG.INGTKHYRLALLVALWLLPRILLWTPT--PLWLTSSIEALFLALVAFEIGSRVVQAKGWRNLFFVPLFLLAIGANFASYA-TIKGMPPFTSSAvWQAMLWWFTLLLSVMGARVIPFFTARRFNFEKAN----PIVWLDWAANLPLVMLFLLSFFPV---TMAQLGQPLMVIAGVAQLVRFIRWKPWLTLSEPLVWSLHAAYLCLPLSLLLRGLLD----NPFASHNLIHLFAIGALAGLILAMIARVTMGHTGRMIYQGP.NMSLAFGAL-FLAALVRSFGVIFAP-AQLFIWIDISAALWVFAFTLFAGSLVICS-----
DSQ  ATTCCCGCTTGGCTGAGATTGGGTTTTCGACCTTTCTTTTTATTAGGCTCGGTGTACGCCATTATCGCTATTGCGGTGTGGGTATGGATTTTTCAAACCGGTCAGCCAACACAA------CTCCAAGTGCCAGGACTTTGGTGGCATGTGCATGAAATGCTGTTTGGTTTTGCGATGGCGATTGTGGCTGGGTTCCTTTTAACCGCGGTACAAAACTGGACGGGC...ATCAACGGCACCAAACATTATCGTTTAGCACTGCTGGTGGCGCTGTGGTTGTTGCCGAGAATTTTGCTTTGGACGCCAACG------CCACTGTGGTTAACCTCCAGCATTGAAGCGCTGTTTCTTGCTTTGGTGGCCTTTGAAATCGGTAGCCGAGTGGTGCAGGCCAAAGGTTGGCGTAATCTCTTTTTCGTCCCACTGTTTTTGTTGGCAATCGGTGCTAATTTTGCCAGCTATGCG---ACAATAAAAGGCATGCCGCCATTTACCTCTTCGGCGgttTGGCAAGCGATGCTTTGGTGGTTCACCTTGCTGTTGTCGGTGATGGGGGCACGCGTGATCCCATTCTTTACCGCGCGTCGTTTTAACTTTGAAAAAGCCAAT------------CCGATTGTTTGGCTCGATTGGGCGGCAAACTTACCTTTGGTGATGCTGTTTTTGCTCAGCTTTTTCCCAGTG---------ACCATGGCACAGCTTGGCCAGCCGTTGATGGTGATCGCGGGTGTCGCGCAACTGGTGCGCTTTATCCGTTGGAAACCTTGGCTGACCCTAAGTGAGCCGTTGGTTTGGTCGTTGCACGCCGCTTATCTGTGTTTACCGTTGAGTCTGCTGTTGCGCGGTTTGCTGGAT------------AATCCGTTCGCGTCACACAACCTGATCCACTTGTTTGCGATTGGGGCTTTGGCTGGGCTTATTCTGGCGATGATTGCACGTGTCACCATGGGGCACACCGGACGAATGATCTACCAAGGGCCG...AATATGAGTCTGGCGTTTGGCGCACTC---TTCCTCGCGGCTTTGGTGCGCAGTTTTGGCGTCATTTTTGCGCCA---GCACAACTGTTTATCTGGATCGACATCAGTGCCGCGCTGTGGGTATTCGCGTTTACACTGTTTGCTGGAAGTTTGGTTATATGCTCG---------------
TRN  10010101100011000
NAM  Q9I0H6_PSEAE/12-392
ASQ  IPPIWRLGFRPFFLGGALFAVLAIALWLAALAGLWSGWQ-PVGGWLAWHRHEMLFGFGVAIIAGFLLTAVQTWTG.VPGLQGKPLALLAGLWLAARLAWLFDA--PLALLLVLQLSFLPLLAWAIGRSLWRVRQKRNYPVVGLLLLLTLADALVLLGLFEGNDDWQRRA.SIAALWLIAGMMNLIGGRVIPFFTQRGLGRQQQVPA---IAWLDNGILLGCVLVALLTAAGVTTQPTPWLAGLF-AALGGAQLWRLWRWRDRGIWQVPLLWSLHLAYFWIAVAPLGMALWS--LGLALAPSQALHALAVGGMGGLILAMLARVTLGHTGRALQPPA.AMPWAFALL-NLGCAARVFLPSLLP---ANWALPLAGGLWALAFLLFAWFYAPMLCRPRV
DSQ  ATACCGCCGATCTGGCGCCTGGGCTTCCGCCCGTTCTTCCTCGGCGGCGCGCTGTTCGCGGTCCTCGCCATCGCGCTCTGGCTAGCGGCGCTGGCCGGGCTCTGGAGCGGCTGGCAA---CCGGTCGGTGGCTGGCTGGCCTGGCATCGTCACGAAATGCTCTTCGGTTTCGGCGTGGCGATCATCGCCGGCTTCCTGTTGACCGCCGTGCAGACCTGGACCGGC...GTACCCGGCCTGCAGGGCAAACCCCTGGCCCTGCTCGCCGGGCTCTGGCTGGCGGCGCGCCTGGCCTGGCTATTCGATGCG------CCGCTGGCGCTGCTGCTGGTGCTGCAACTGAGCTTCCTGCCGCTATTGGCCTGGGCTATCGGTCGCAGCCTGTGGCGGGTGCGGCAGAAGCGCAATTACCCGGTGGTGGGCCTGTTGCTGCTGTTGACCCTGGCCGACGCCCTGGTCCTGCTCGGCCTGTTCGAGGGCAACGACGACTGGCAACGGCGTGCC...TCCATCGCCGCGCTATGGCTGATCGCCGGGATGATGAACCTGATCGGCGGGCGGGTGATCCCGTTCTTCACCCAGCGCGGTCTCGGCCGTCAGCAGCAGGTGCCGGCG---------ATCGCCTGGCTGGACAATGGCATCCTGCTGGGCTGCGTGCTGGTGGCGCTGCTCACCGCCGCGGGCGTCACGACGCAGCCGACGCCCTGGCTTGCAGGACTGTTC---GCCGCCCTCGGTGGTGCGCAACTGTGGCGCCTGTGGCGTTGGCGCGATCGCGGCATCTGGCAGGTGCCGCTGCTCTGGTCTCTGCACCTGGCATATTTCTGGATCGCCGTGGCGCCGCTTGGCATGGCGCTCTGGAGC------CTGGGCCTGGCGCTGGCGCCGAGCCAGGCGCTGCACGCGCTGGCGGTGGGCGGCATGGGCGGGTTGATCCTGGCGATGCTGGCACGGGTCACTCTCGGCCATACCGGTCGCGCGCTGCAACCGCCGGCA...GCGATGCCCTGGGCTTTCGCTCTGCTC---AATCTCGGCTGCGCGGCGCGGGTGTTCCTGCCCAGCCTGTTGCCG---------GCGAACTGGGCGCTGCCCCTGGCAGGCGGACTGTGGGCTTTGGCGTTCCTGCTGTTCGCCTGGTTCTATGCGCCGATGCTGTGTCGTCCGCGGGTC
TRN  10010101100011011
NAM  P95556_PSEST/12-391
ASQ  IAPIWRLAFRPFFLAGSLYALLAIPLWVAAWTGLWPGFQ-PTGGWLAWHRHEMLFGFAMAIVAGFLLTAVQTWTG.QTAPSGNRLVGLAAVWLAARLGWLFGL--PAAWLAPLDLLFLVALVWMMAQMLWAVRQKRNYPIVVVLSLMLGADVLILTGLLQGNDALQRQG.VLAGLWLVAALMALIGGRVIPFFTQRGLGKVDAVK---PWVWLDVALLVGTGVIALLHAFGVAMRPQPLLGLLF-VAIGVGHLLRLMRWYDKGIWKVGLLWSLHVAMLWLVVAAFGLALWH--FGLLAQSSPSLHALSVGSMSGLILAMIARVTLGHTGRPLQLPA.GIIGAFVLF-NLGTAARVFLSVAWP----VGGLWLAAVCWTLAFALYVWRYAPMLVAARV
DSQ  ATCGCGCCCATCTGGCGGCTCGCATTTCGCCCGTTTTTTCTCGCCGGCAGCCTGTATGCGCTGCTCGCCATTCCTCTATGGGTCGCCGCATGGACCGGTCTATGGCCGGGCTTTCAA---CCAACCGGCGGCTGGTTGGCATGGCACCGTCACGAGATGCTATTTGGCTTTGCCATGGCGATCGTCGCCGGCTTTCTGCTTACCGCGGTGCAGACGTGGACCGGC...CAGACGGCCCCGTCCGGTAATCGCTTGGTAGGTCTGGCCGCGGTCTGGTTGGCGGCGCGCCTGGGCTGGTTGTTCGGCCTG------CCAGCGGCATGGCTGGCGCCATTGGATCTGCTGTTCCTGGTGGCGTTGGTCTGGATGATGGCGCAGATGCTCTGGGCCGTACGGCAGAAGCGCAACTACCCGATTGTCGTGGTGCTTTCCCTGATGCTCGGTGCCGACGTGCTCATCCTGACCGGTCTGTTGCAGGGCAACGATGCGCTGCAACGGCAGGGC...GTGCTTGCCGGGCTGTGGCTGGTCGCGGCGTTGATGGCGTTGATCGGCGGCCGGGTGATCCCGTTCTTTACCCAGCGCGGGTTGGGCAAGGTTGACGCGGTCAAG---------CCCTGGGTCTGGCTGGACGTCGCGTTGTTGGTAGGTACCGGGGTGATCGCCCTGTTGCACGCCTTCGGTGTAGCCATGCGACCGCAACCGTTGCTGGGCCTGCTGTTC---GTTGCGATCGGCGTTGGTCACCTGCTGCGCCTGATGCGTTGGTATGACAAGGGAATCTGGAAGGTCGGGCTGCTCTGGTCGCTGCATGTGGCGATGCTCTGGTTGGTAGTCGCCGCATTTGGCCTGGCGCTCTGGCAT------TTCGGCCTGCTGGCGCAATCCAGTCCTTCATTGCATGCGCTTAGCGTGGGTTCGATGAGTGGCCTGATCCTAGCGATGATTGCGCGCGTGACGTTGGGTCATACCGGCCGGCCGCTGCAGTTACCAGCG...GGCATCATCGGCGCCTTCGTGCTGTTC---AATCTGGGCACGGCAGCGCGGGTGTTCCTCTCCGTCGCCTGGCCG------------GTAGGTGGTCTGTGGTTGGCTGCGGTCTGCTGGACCCTGGCCTTCGCACTGTATGTCTGGCGCTATGCGCCGATGCTGGTGGCCGCCCGTGTG
TRN  11011111101111100
NAM  Q8EDE7_SHEON/13-385
ASQ  KLPLFRLGFRPFFLFASLFSLLSLGIWGGFLAGNALLP--NSINPLWWHGHEMIFGFVCAVVAGFLLTAVQNWTG.QPGLKGLPLAGLFIVWLLPRLLFILPLDIPFVITMIIDLLFLPLTAVLLSISVIKVRQWRNFVFIPILSLLTLFNGLSYYGLISDQLHWTHNG.LYAAIILIAVIVALLGGRVIPFFTERAAQWQK--PMPIPLLEF-------LSFASLLALIASLFLTQLLLTRSLAGIAGCVLLLRWSRWGWHASWSVPLLWSLHLSYLCIPIGL---GLIA----TGLPLSVGMHAITVGGLGGMILAMMSRVSLGHTGRPLKPAR.PMALAFGLI-LFAALLRVLAGL--PSAWFIELMLAAIICWMLAFGCFCYCYAPMLCRVRV
DSQ  AAACTGCCACTTTTTCGCTTAGGTTTTAGACCTTTTTTCTTATTCGCGAGCCTGTTTAGCCTGTTAAGTTTAGGGATATGGGGAGGATTTCTTGCCGGTAACGCTTTGCTTCCT------AACAGCATAAATCCGTTATGGTGGCATGGCCATGAGATGATTTTCGGTTTTGTGTGTGCCGTCGTAGCAGGCTTTTTACTCACTGCCGTTCAAAACTGGACGGGG...CAACCAGGGTTAAAAGGCTTACCACTCGCTGGATTATTTATTGTTTGGTTACTTCCAAGGCTCTTATTTATTTTACCGCTAGATATTCCGTTTGTGATAACCATGATCATCGACTTGCTGTTTTTACCATTAACTGCGGTTTTATTATCAATTTCAGTAATTAAAGTACGTCAATGGCGCAACTTTGTGTTTATCCCAATACTCAGTTTACTCACGCTTTTTAATGGGTTGAGTTATTACGGCTTAATCTCGGATCAATTGCATTGGACTCATAATGGC...CTTTATGCCGCAATCATTCTCATTGCCGTGATAGTCGCTCTGCTTGGCGGCAGAGTGATCCCATTCTTTACCGAACGCGCAGCCCAATGGCAAAAA------CCAATGCCCATTCCATTACTGGAATTT---------------------TTAAGCTTTGCCAGCCTATTAGCGCTCATCGCTAGCCTCTTTTTAACGCAGTTATTATTGACGCGCTCTTTGGCAGGTATCGCGGGCTGTGTATTATTGCTGCGCTGGTCGCGGTGGGGATGGCACGCCAGTTGGTCCGTACCGCTGTTATGGTCACTGCATTTAAGTTACTTATGCATCCCCATTGGTTTA---------GGGCTAATTGCG------------ACTGGACTGCCGCTTTCTGTAGGAATGCATGCCATTACCGTTGGAGGACTCGGTGGAATGATCCTCGCAATGATGTCTCGCGTATCGCTCGGCCATACGGGCAGGCCGCTTAAACCTGCTCGG...CCAATGGCATTGGCTTTTGGATTAATC---TTGTTCGCTGCGCTGCTGCGTGTTTTAGCGGGTTTA------CCTAGTGCGTGGTTTATCGAATTAATGCTCGCTGCGATTATTTGTTGGATGCTTGCTTTTGGTTGTTTCTGTTACTGTTATGCGCCTATGCTTTGCCGCGTTAGAGTC
TRN  10010101100011000
NAM  Q93SI1_BRAJA/11-390
ASQ  GWPLFANSFRPFFLLAAIQAGLSILAWLPMFYGELSVT--SAFAPRDWHVHEMLYGFLPAVITGFLFTAIPNWTG.RLPIQGTSLGALLAVWLAGRLAVTLSAEVGWAFALVVDAAFLALVVAAATREIIAGGNWRNLPVVILVLVLLTGNVGFHLEAHYAGAADVS--.IRVGIGVVVLLIALIGGRIIPSFTRNWLVKFNPGRLPVPFGRFDGAVIA-LSALALISW---IVAPLNVVTGAAMALVGVLHLVRLARWAGDRTSRERLLLILHVGYVFVPLGFLLHALAV--FGA-LPPSAGIHAWMAGAAGTMTLAVMTRASLGHTGQTLTASP.ATQGIYVAI-IAAALARVAAVVW--PAHADALLHIAACGWVVAFLGFAIAFGPLLAGSSR
DSQ  GGCTGGCCGCTGTTCGCGAACAGCTTTCGGCCCTTTTTCCTGCTCGCCGCCATCCAGGCAGGGCTCTCGATCCTGGCCTGGCTGCCGATGTTCTACGGCGAATTGTCGGTGACG------TCAGCCTTCGCGCCGCGCGACTGGCACGTCCACGAGATGCTCTATGGCTTCCTGCCGGCGGTCATCACCGGGTTCCTGTTTACGGCGATCCCGAACTGGACCGGG...CGGCTGCCGATCCAGGGCACGTCGCTGGGCGCGTTGCTGGCGGTGTGGCTGGCCGGCCGCCTCGCGGTGACGCTGTCCGCCGAGGTCGGCTGGGCGTTCGCGCTTGTCGTCGATGCCGCGTTCCTGGCGCTGGTCGTCGCCGCCGCGACGCGCGAGATCATCGCGGGCGGCAATTGGCGCAACCTTCCCGTGGTGATCCTGGTGCTCGTGCTGCTCACCGGCAATGTCGGCTTTCATCTCGAAGCGCACTACGCGGGCGCGGCCGATGTCAGC------...ATCCGCGTCGGCATCGGCGTGGTCGTGCTGCTGATCGCGCTGATCGGAGGCCGCATCATTCCGAGCTTCACCCGCAACTGGCTGGTCAAGTTCAATCCCGGCCGCCTGCCGGTCCCGTTCGGCCGCTTCGATGGCGCGGTGATCGCA---TTGAGCGCGTTGGCGCTGATCTCGTGG---------ATCGTGGCGCCGTTGAATGTGGTGACCGGCGCCGCGATGGCGCTCGTCGGCGTGCTGCATCTGGTGCGGCTTGCGCGCTGGGCTGGCGACCGCACCTCGCGCGAGCGGCTGCTCCTGATCCTGCATGTCGGCTATGTCTTCGTGCCGCTCGGTTTCCTCCTGCATGCGTTGGCCGTG------TTCGGTGCG---TTGCCGCCGAGCGCGGGGATTCACGCCTGGATGGCGGGCGCCGCCGGAACGATGACGCTCGCGGTGATGACGCGTGCGAGCCTCGGCCACACCGGACAGACCCTGACGGCCTCGCCG...GCGACACAAGGTATCTACGTCGCGATC---ATCGCCGCGGCGCTGGCGCGGGTTGCTGCCGTGGTGTGG------CCTGCGCATGCCGATGCACTGCTGCACATTGCCGCCTGCGGCTGGGTCGTCGCCTTCCTCGGCTTTGCGATTGCGTTCGGCCCGCTGCTCGCCGGCAGCAGCCGG
TRN  11011111101111101
NAM  Q936J2_RHOSH/11-390
ASQ  GPALLSYGFRPFFLLSALFAAGAVPVWLAVWSGRIGLA--GPFSPIDWHIHEMLFGYTSAVIAGFLFTAIPNWTG.RMPRRGLPLAALAALWIAGRFAVAGAFGTDPLLVLVIDAGFLLAVTLMAVIEIAAGKNWKNLMVVGPVGLYLAANVLFHLEAMQQGESDIG--.RPLGFATVTFLIMLIGGRIIPSFTRNWLAKGGPGPLPVPFGRFDGASLL-VAVGALLCW---TLAPDAILTAALLALAAALHVVRLVRWRGHLVWRSPLLLMLHVAYGFLPLGLAATAAAA--VGW-ASAPAGLHLLGIGAIGGMTLAVMMRASLGHTGRPLEAGR.ALSAGFACI-VAAAAARTVLAAT--DIGGIDGYSLAAAFWTMGFAIYVGRIGPCLLRPSL
DSQ  GGACCCGCGCTGCTCAGCTACGGGTTCCGACCCTTCTTCCTCCTCTCGGCCCTCTTCGCCGCCGGCGCCGTCCCGGTCTGGCTGGCGGTGTGGAGCGGACGGATCGGGCTCGCC------GGCCCCTTCTCTCCGATCGACTGGCACATCCACGAGATGCTGTTCGGCTATACGTCGGCCGTGATCGCCGGGTTCCTCTTCACGGCGATACCGAACTGGACGGGC...CGGATGCCGCGCCGGGGCCTGCCGCTGGCCGCCCTCGCCGCCCTCTGGATCGCGGGCCGCTTCGCCGTCGCCGGCGCCTTCGGCACCGATCCGCTTCTCGTGCTTGTCATCGATGCGGGCTTCCTGCTCGCCGTCACCCTGATGGCCGTGATCGAGATCGCGGCGGGGAAGAACTGGAAGAACCTCATGGTGGTCGGGCCCGTGGGCCTCTATCTGGCCGCCAATGTCCTCTTCCACCTCGAGGCGATGCAGCAGGGCGAAAGCGACATCGGC------...CGCCCCCTCGGCTTTGCCACCGTGACCTTCCTCATCATGCTGATCGGCGGGCGCATCATCCCGAGCTTCACCCGCAACTGGCTGGCCAAGGGCGGCCCCGGCCCCCTGCCCGTCCCCTTCGGCCGGTTCGACGGCGCGAGCCTCCTT---GTCGCGGTCGGCGCTCTCCTGTGCTGG---------ACGCTGGCGCCCGACGCGATCCTGACGGCGGCACTCCTCGCCCTGGCCGCCGCGCTCCACGTCGTCCGCCTCGTGCGGTGGCGGGGCCACCTCGTCTGGCGCTCTCCGCTCCTTCTCATGCTCCATGTCGCCTACGGCTTCCTGCCCCTCGGCCTGGCCGCCACGGCGGCGGCCGCG------GTGGGCTGG---GCTTCGGCCCCGGCCGGGCTGCATCTCCTCGGGATCGGCGCCATCGGGGGCATGACGCTGGCGGTGATGATGCGCGCCTCGCTCGGCCACACCGGCCGCCCGCTCGAGGCCGGACGG...GCCCTCTCCGCCGGCTTTGCCTGCATC---GTGGCCGCGGCCGCCGCCCGGACGGTTCTTGCCGCGACC------GACATCGGCGGGATCGACGGCTACAGCCTTGCCGCGGCCTTCTGGACCATGGGCTTCGCGATCTATGTCGGCCGGATCGGTCCCTGCCTGCTGCGGCCCTCGCTC
TRN  10010111100111011
NAM  Q92Z28_RHIME/21-400
ASQ  GPVLFSYGFRPFFLGAAVWAVVAMTLWIAALVGHLEVA--GSYGAHAWHAHEMLFGFAPAVLAGFLLTAVPNWTG.RLPVSGWPLAGLFTLWLAGRAALLSPDVIGIPPAAAIDGLFLPALLLICAREVIAGRKWKDLKVLGGLLALSLANACFHFAVVTGDHVHIA--.MRLGISAYVALVTIIGGRILPSFTRNWLNRAGRTEFPVPYNHFDTVAIL-AGIAALGAW---TLAPDHPVTAVPAFAAALLHTVRLARWRGWRTWPEMLLVILHVAYAFVPLGFAATGIGA--LGF-VEELSVMHVLTVGAIAAMMLAVMTRASRGHTGYPLTASR.LTAASYAAV-VLSALLRPLAEML--PEIAPTLYAVSGSAWILAFALFCIEYGPILVRKRR
DSQ  GGCCCGGTGCTCTTTTCGTACGGATTCAGACCCTTCTTCCTGGGCGCCGCTGTTTGGGCGGTCGTCGCTATGACGCTCTGGATTGCAGCCCTCGTAGGTCATCTCGAAGTCGCC------GGCAGCTATGGGGCTCACGCCTGGCATGCGCACGAGATGCTGTTCGGCTTCGCCCCGGCTGTCCTTGCCGGCTTCTTGCTGACCGCGGTACCGAACTGGACGGGC...CGCCTCCCCGTATCCGGCTGGCCGCTCGCCGGACTGTTCACGCTCTGGCTGGCGGGACGCGCGGCGCTGCTTTCCCCGGACGTGATCGGCATCCCGCCCGCAGCGGCGATAGACGGCCTCTTCCTCCCGGCGCTGCTCTTGATCTGCGCCCGCGAGGTAATCGCCGGCCGCAAGTGGAAGGATCTGAAGGTGTTGGGCGGCCTCCTAGCGTTGTCGCTCGCCAATGCCTGCTTTCATTTCGCCGTGGTCACGGGAGACCATGTCCATATCGCG------...ATGCGCCTTGGCATTTCCGCCTATGTGGCTCTCGTCACCATTATCGGCGGTCGGATCTTGCCGAGCTTCACCCGCAACTGGCTGAATCGTGCCGGCCGGACCGAATTTCCCGTCCCCTACAACCACTTCGACACAGTCGCCATTCTC---GCAGGCATCGCAGCGCTTGGCGCATGG---------ACGCTTGCTCCCGACCATCCGGTCACGGCAGTGCCGGCTTTTGCCGCCGCACTGCTGCACACCGTCCGGCTCGCCCGCTGGCGCGGTTGGCGCACCTGGCCTGAAATGCTGCTCGTCATACTGCACGTCGCCTATGCCTTCGTTCCCCTGGGCTTCGCCGCAACCGGCATTGGCGCG------CTCGGCTTC---GTCGAAGAACTCTCGGTCATGCATGTGCTCACAGTGGGCGCCATCGCCGCGATGATGCTAGCGGTCATGACCCGCGCGAGCCGCGGCCACACGGGCTATCCGCTTACCGCATCGCGA...TTGACGGCCGCCTCCTATGCCGCGGTC---GTGTTGTCGGCACTGTTGCGCCCGCTGGCGGAAATGCTC------CCCGAGATCGCACCGACACTCTATGCCGTCTCCGGAAGCGCGTGGATCCTGGCCTTCGCGCTGTTCTGCATTGAGTATGGCCCAATCCTGGTTCGCAAGCGCCGG
TRN  10010101100011011
NAM  Q8U7R6_AGRT5/41-420
ASQ  GPVIFSYGFRPFFLGGALWAIVAMVLWIAALSGFIDIG--GDYGAPNWHAHEMLFGFASAVLAGFLLTAVPNWTG.RLPVSGKPLVWLFALWCAGRLLLLVPDQVGVVTAAAVDGLFLPALLAICAREVIAGRKWKDLKVLGGLLALSVANIVFHVAAIGGDHSQMA--.TRLAVSAYTVLVIIVGGRIVPSFTRNWLNRFGRTDFPVPYNGFDTAAIL-TGIVALAVW---TIEPESMLAVSTALLAAFMHAVRLIRWRGWTTRPEQVLVVLHVAYAFIPVGFIAIALAA--LDV-MDTRSVLHIFTVGVIGCMMLAVMTRASLGHTGRKLAASR.LTIAAYVSL-IACALLRPAAEFL--PGVMMHLYGCSALLWIVGFGLFCVEYGPILMRERK
DSQ  GGCCCGGTTATCTTTTCTTACGGCTTCCGGCCGTTTTTCCTCGGCGGCGCCCTCTGGGCCATCGTGGCGATGGTGTTGTGGATCGCAGCCCTTTCCGGCTTCATCGATATTGGC------GGAGACTATGGCGCGCCGAACTGGCATGCCCATGAGATGCTGTTCGGTTTCGCTTCAGCGGTGCTGGCCGGCTTTCTCCTGACGGCTGTGCCGAACTGGACGGGG...CGGCTGCCGGTGTCGGGCAAACCGCTGGTCTGGCTGTTTGCGCTCTGGTGCGCCGGCCGGCTTTTGCTGCTCGTGCCGGATCAGGTGGGCGTGGTCACCGCCGCAGCCGTCGACGGGCTGTTCCTGCCGGCGCTGCTGGCGATCTGCGCGCGCGAGGTTATTGCCGGACGCAAATGGAAGGACCTGAAGGTGCTGGGCGGGCTGCTGGCGCTTTCCGTCGCCAATATTGTTTTCCATGTGGCGGCGATTGGCGGCGATCACAGCCAGATGGCG------...ACCCGCCTTGCCGTCTCGGCTTATACCGTGCTCGTCATCATCGTCGGTGGCCGCATCGTGCCGAGTTTCACCCGCAACTGGCTGAACCGTTTTGGCCGCACGGATTTTCCCGTGCCCTATAACGGCTTCGACACCGCCGCCATCCTC---ACCGGCATCGTGGCGCTTGCCGTGTGG---------ACAATAGAGCCTGAGAGCATGCTGGCCGTGTCCACGGCGCTTCTGGCCGCGTTCATGCACGCTGTGCGTCTCATCCGCTGGCGCGGCTGGACGACCCGGCCGGAGCAGGTGCTGGTGGTGTTGCATGTGGCCTATGCCTTCATTCCCGTTGGGTTCATTGCCATCGCTCTGGCGGCT------CTTGATGTC---ATGGACACGCGCTCCGTCCTGCACATCTTCACCGTCGGCGTTATCGGCTGCATGATGCTTGCGGTGATGACGAGAGCGAGCCTTGGCCATACCGGACGCAAGCTCGCGGCTAGCAGG...CTGACCATTGCAGCTTACGTATCTCTG---ATCGCCTGCGCGCTGCTGAGACCGGCAGCCGAGTTCCTT------CCCGGCGTTATGATGCATCTTTATGGCTGCTCGGCGCTTCTCTGGATCGTGGGTTTTGGTCTCTTCTGCGTCGAATACGGGCCGATCCTGATGCGCGAACGCAAA
TRN  10010101100011001
NAM  Q8YBD6_BRUME/30-409
ASQ  GPVILSYGFRPFFLGGAIWAVMAMLLWILSLTIGLPLG--GSYGALNWHAHEMVFGFSSAVLAGFLLTAVPNWTG.RLPVSGGPLAVLCGVWLAGRLAFLAPDLVHIDVAVAIESLFLPFLLFIAAREIIAGHHWRNLKVLGGIAGVMIANFAFHYLVLTDGDVTFA--.NRIGVSAYVILVTLIGGRIIPSFTRNWLNRMGKTRFPVPFNRYDALTLI-VGVVACLSW---IFLPESSLTAVLALIAAAFHLVRLYRWRGWTVAREKLLVILHVAYLFVPGGFVAIALSA--LDR-LNPFSALHVMTVGAIGAMMLAVMTRATRGHTGRELVASP.MTQIAYVCI-IAAAVIRPFAEIM--PNFFHTLLAASALLWMLAFGLFVVEYGPMLLRKRR
DSQ  GGCCCGGTCATTTTAAGCTATGGTTTCAGACCGTTTTTTCTGGGCGGCGCCATATGGGCCGTCATGGCAATGCTGTTGTGGATCTTGTCCCTCACCATCGGCCTGCCGCTGGGG------GGCTCCTATGGAGCCCTCAACTGGCATGCACATGAAATGGTGTTCGGCTTTTCGTCCGCCGTTCTGGCGGGGTTCCTGCTGACCGCCGTACCCAACTGGACCGGC...AGGCTGCCGGTTTCGGGCGGGCCGCTTGCGGTGCTGTGCGGCGTGTGGCTTGCCGGGCGGCTCGCCTTTCTCGCGCCCGATCTCGTGCATATTGATGTGGCTGTCGCCATTGAAAGCCTGTTTCTGCCTTTCCTGCTGTTCATTGCAGCGCGCGAAATCATCGCGGGCCATCACTGGCGCAATCTGAAAGTGCTGGGTGGCATTGCCGGCGTCATGATCGCCAATTTCGCTTTCCATTATCTGGTGCTCACCGATGGCGATGTGACATTTGCC------...AACCGTATTGGCGTCAGTGCCTATGTGATTCTGGTCACGCTGATTGGCGGGCGCATCATCCCAAGCTTTACCCGCAACTGGCTGAACCGCATGGGCAAGACGCGGTTTCCCGTGCCCTTCAACCGCTACGATGCACTGACCCTCATT---GTTGGTGTGGTTGCCTGCCTGAGCTGG---------ATTTTCCTGCCGGAAAGCTCGCTGACGGCAGTGCTGGCACTCATCGCGGCGGCATTCCATCTGGTGCGGCTCTATCGCTGGCGCGGCTGGACCGTTGCGCGTGAAAAGCTGCTCGTCATCCTGCATGTGGCCTATCTGTTCGTGCCGGGCGGTTTCGTTGCCATCGCGCTCTCCGCG------CTTGACCGG---CTCAATCCCTTTTCGGCGCTACATGTGATGACAGTCGGTGCGATCGGCGCAATGATGCTTGCCGTCATGACCCGCGCCACGCGCGGCCATACCGGGCGCGAACTGGTCGCTTCACCC...ATGACGCAGATTGCCTATGTCTGCATC---ATCGCCGCCGCCGTGATCCGGCCTTTCGCAGAGATTATG------CCGAATTTCTTCCACACATTGCTTGCCGCATCCGCGCTTTTATGGATGCTGGCTTTTGGCCTCTTTGTGGTGGAATATGGTCCCATGCTGTTGCGCAAACGCCGC
TRN  10010101100011000
NAM  Q8XTZ6_RALSO/23-398
ASQ  GLPVFALGFRPFYLLAAAFAVIGMALWAALLLGGFSAAHGPTLPPLFWHAHEMVFGVAAAVVVGFLFTAGKNWTG.LQTPQGPLLAALAAVWLAARILMWTGP---GPLAVAVDVAFLPLCGVLFLRILRRAANARNYGLAAALLILGAVNAGFHFALMAGAPLLALRC.VDAAAGLVAMFVTVIGGRVIPMFSTNAIPGIRIRR----AAWAERAIV-PLTLAAVIVL---ALPVSGVVPAAVFASAAVAQVVRWVGWNSVRTLRTPIVAILHVAYGFLPLGFGLLAVSA--LGG-IDRSTALHALTVGAIGGAIVAMITRTALGHTGRPLRAGH.AERLAYAAI-ALAALVRVVGPLL--LPRG-IWIGVSSAGWVVAFAVYLWKYTPWLLAPRV
DSQ  GGCCTGCCGGTCTTTGCCCTCGGCTTCCGGCCGTTCTATCTGCTGGCCGCGGCGTTTGCGGTGATCGGCATGGCGCTGTGGGCGGCGCTGCTGCTGGGCGGGTTCTCCGCCGCGCACGGCCCCACGCTGCCGCCGTTGTTCTGGCATGCGCACGAGATGGTGTTCGGCGTTGCGGCGGCGGTGGTGGTGGGCTTCCTGTTCACGGCCGGCAAGAACTGGACCGGG...CTGCAGACGCCGCAAGGCCCGCTGCTGGCGGCGCTCGCGGCCGTCTGGCTGGCGGCGCGCATACTGATGTGGACCGGCCCG---------GGGCCGCTGGCCGTGGCGGTCGATGTCGCGTTCCTGCCGCTGTGCGGCGTGCTGTTCCTGCGCATCCTGCGGCGCGCGGCGAATGCGCGCAATTATGGTCTTGCGGCGGCCCTGCTGATCCTGGGCGCCGTCAACGCCGGCTTCCATTTCGCGCTGATGGCCGGCGCACCGCTGCTCGCCCTGCGCTGC...GTCGACGCGGCGGCCGGACTGGTCGCCATGTTCGTCACGGTGATCGGCGGGCGCGTGATCCCGATGTTCTCCACCAATGCCATTCCCGGCATCCGCATCCGGCGT------------GCCGCGTGGGCCGAGCGCGCCATCGTG---CCGCTGACGCTGGCGGCGGTGATCGTGCTG---------GCCTTGCCGGTGAGCGGCGTGGTGCCGGCCGCCGTGTTCGCGTCGGCGGCCGTGGCCCAGGTGGTCCGGTGGGTAGGCTGGAATTCGGTGCGGACCCTGCGCACGCCCATCGTTGCCATTCTGCATGTCGCCTATGGCTTCCTGCCGCTCGGGTTCGGCCTGCTCGCCGTGTCGGCT------CTGGGCGGG---ATCGACCGTTCGACCGCGCTGCACGCGCTGACGGTCGGCGCCATCGGCGGGGCGATCGTCGCCATGATCACGCGCACGGCACTCGGCCATACCGGCCGCCCGCTGCGCGCGGGCCAC...GCGGAGCGCCTCGCCTATGCGGCCATC---GCGCTGGCGGCGCTGGTGCGCGTGGTCGGGCCGCTGCTG------CTGCCGCGCGGC---ATCTGGATCGGCGTGTCGTCGGCAGGCTGGGTGGTGGCGTTCGCCGTCTATCTGTGGAAATACACGCCGTGGTTGCTCGCGCCGCGCGTT
TRN  10010101100011011
NAM  Q9JT11_NEIMA/21-395
ASQ  KHPVWAMAFRPFYSLAALYGALSVLLWGFGYTGTHEL------SGFYWHAHEMIWGYAGLVVIAFLLTAVATWTG.QPPTRGGVLVGLTIFWLAARIAAFIPGW-GASASGILGTLFFWYGAVCMALPVIRSQNQRNYVAVFALFVLGGTHAAFHVQLHNGNLGGLLSG.LQSGLVMVSGFIGLIGTRIISFFTSKRLNVP---QIPSPKWVAQASLWLPMLTAMLMAH-----GVMPWLSAAFAFAAGVIFTVQVYRWWYKPVLKEPMLWILFAGYLFTGLGLIAVGASY--FKP-AFLNLGVHLIGVGGIGVLTLGMMARTALGHTGNPIYPPPkAVPVAFWLM-MAATAVRMVAVFSS-GTAYTHSIRTSSVLFALALLVYAWKYIPWLIRPRS
DSQ  AAGCACCCCGTTTGGGCAATGGCGTTCCGCCCGTTTTATTCACTGGCGGCTCTGTACGGCGCATTGTCCGTATTGCTGTGGGGTTTCGGCTACACGGGAACGCACGAGCTG------------------TCCGGTTTCTATTGGCACGCGCATGAGATGATTTGGGGTTATGCCGGACTGGTCGTCATCGCCTTCCTGCTGACCGCCGTCGCCACTTGGACGGGG...CAGCCGCCCACGCGGGGCGGCGTTCTGGTCGGCTTGACTATCTTTTGGCTGGCTGCGCGGATTGCCGCCTTTATCCCGGGTTGG---GGTGCGTCGGCAAGCGGCATACTCGGTACGCTGTTTTTCTGGTACGGCGCGGTGTGCATGGCTTTGCCCGTTATCCGTTCGCAGAATCAACGCAATTATGTTGCCGTGTTCGCGCTGTTCGTCTTGGGCGGTACGCACGCGGCGTTCCACGTCCAGCTGCACAACGGCAACCTAGGCGGACTCTTGAGCGGA...TTGCAGTCGGGCTTGGTGATGGTGTCGGGTTTTATCGGTCTGATTGGTACGCGGATTATTTCGTTTTTTACGTCCAAACGGTTGAATGTGCCG---------CAGATTCCCAGTCCGAAATGGGTGGCGCAGGCTTCGCTGTGGCTGCCCATGCTGACCGCCATGCTGATGGCGCAC---------------GGCGTGATGCCTTGGCTGTCGGCGGCTTTCGCGTTTGCGGCAGGTGTGATTTTTACCGTGCAGGTGTACCGCTGGTGGTATAAGCCTGTGTTGAAAGAGCCGATGCTGTGGATTCTGTTTGCCGGCTATCTGTTTACCGGATTGGGGCTGATTGCGGTCGGCGCGTCTTAT------TTCAAACCC---GCTTTCCTCAATCTGGGTGTGCATCTGATCGGGGTCGGCGGTATCGGCGTGCTGACTTTGGGCATGATGGCGCGTACCGCGCTCGGTCATACGGGCAATCCGATTTATCCGCCGCCCaaaGCCGTTCCCGTTGCGTTTTGGCTGATG---ATGGCGGCAACCGCCGTCCGTATGGTTGCCGTATTTTCTTCC---GGCACTGCCTACACGCACAGCATACGCACCTCTTCGGTTTTGTTTGCACTCGCGCTTTTGGTGTATGCGTGGAAGTATATTCCTTGGCTGATTCGTCCGCGTTCG
TRN  10010101100011001
NAM  Q92Z46_RHIME/1-365
ASQ  MSSIWRAPYRPLFFLAGLWALIVPIVWLL--------PEQLVPDRVEWHSRELLFGMGGAAAGGYLLTALPAWTRgAVPPAATVIA--TCLWCAARLTGAFSDHLPLIAAAIGVSGYFAFLTAMLMRGVVVSRAWARCWAPLGTGAL---GVNAFVSIADGPSPTP---.-----LLFAALIVVVGGRAVPAFTGSWLYRTAGGKSLRNRRELSHLAVAGILIATFLHGDW-----SPTLPGLLLLFSGAMLLWQMSEWRSLGTRGYPALFILHVAFAWTPTALLLGGLSATISGH-VPADDALHALTMGAMGTMIAAFMMRPAMVRDGESLILGG.TMAGAFSLV-SLSALLRTSGGWL--DADHFEPEAAAAICWMAGWTLFLIAYLPAMSGPVP
DSQ  ATGAGCTCAATCTGGCGGGCGCCATACCGGCCACTTTTCTTTCTCGCGGGACTATGGGCGCTTATCGTGCCTATTGTCTGGCTCCTC------------------------CCGGAACAACTCGTGCCGGACAGGGTCGAGTGGCACAGCCGCGAGCTTCTGTTCGGCATGGGCGGAGCTGCGGCAGGGGGCTATCTCCTGACGGCCCTGCCGGCCTGGACGAGGgggGCCGTCCCGCCGGCCGCCACTGTGATCGCT------ACCTGCCTCTGGTGCGCGGCCCGTCTGACCGGCGCGTTCTCGGATCATCTGCCCCTTATCGCTGCCGCGATCGGGGTCTCGGGCTATTTCGCGTTCCTGACCGCGATGCTGATGCGTGGCGTCGTGGTCTCCCGGGCTTGGGCTCGGTGCTGGGCGCCGCTTGGGACAGGCGCGCTT---------GGCGTAAATGCCTTCGTTAGCATCGCCGATGGCCCGAGTCCCACGCCT---------...---------------CTGCTTTTTGCCGCGCTGATCGTCGTGGTAGGCGGACGCGCCGTGCCCGCGTTCACCGGCTCCTGGCTATACCGGACAGCGGGAGGGAAGTCCCTCCGCAATCGGCGGGAGCTTTCGCATCTGGCGGTCGCGGGCATTCTCATCGCGACCTTTCTTCATGGCGACTGG---------------TCGCCGACGCTGCCAGGTCTCCTGCTGTTGTTTTCTGGCGCTATGCTGCTGTGGCAGATGAGCGAATGGCGGAGCCTCGGGACCCGCGGCTACCCGGCCTTGTTCATCCTGCATGTCGCCTTCGCCTGGACGCCGACGGCGCTCCTTCTGGGCGGTCTTTCAGCTACTATATCCGGCCAT---GTTCCAGCAGATGACGCCCTGCACGCGCTGACGATGGGCGCGATGGGTACAATGATTGCCGCCTTCATGATGCGCCCGGCCATGGTCCGCGACGGCGAGTCCCTGATCCTCGGCGGG...ACCATGGCTGGCGCGTTCTCGCTCGTG---TCGCTCTCGGCGCTGCTGCGGACTTCCGGTGGCTGGCTG------GATGCAGACCATTTCGAACCCGAAGCCGCTGCCGCAATCTGCTGGATGGCGGGGTGGACGCTCTTTCTGATAGCATATCTTCCGGCCATGAGCGGCCCTGTTCCC
TRN  10010101100011001
NAM  Q8U7P5_AGRT5/3-388
ASQ  QPPILSEALRLFFPLAALHGAVWPFLWIVIGGYALPFA--NAVPPSQWHAHEMIFGTYGMALAGFLGSAVPEWTD.TKAAAGRTLLCLAGLWLPGRLIGFVGADTWSLLAGFFDLAFLLALSVLIGKAMLVRRTTKHLAFLVWLILFAAAETGVRYAWWMGDLEFAVRC.LEAALCIFIVLFSLSAARINVVVINLALDPSGETTPYRPHPGRQHMA-GAMVTLYMAAK---LLFPESDVCAWLALAAGAAFFDRLAEWFIGRAVFRTEVLLLALGNAFAGAGFLALGATR--LGFSVTSAAGLHLLSVGALGCAIMAVFIIAGLRHTGRDLKHLP.WQAHAAAALMVMAGLTRILPEFDVAAVLSPYHHGLSAILWAASFGIWLQGFLPFMRAPGT
DSQ  CAACCACCAATTCTTTCGGAAGCTTTGCGGTTGTTTTTCCCTCTGGCCGCCCTGCATGGCGCGGTCTGGCCGTTTTTGTGGATTGTCATCGGCGGCTACGCCTTACCTTTCGCC------AATGCCGTTCCGCCCTCGCAATGGCATGCCCATGAAATGATTTTCGGCACCTATGGCATGGCGCTCGCTGGTTTTCTCGGTTCGGCAGTGCCTGAATGGACCGAT...ACGAAAGCGGCGGCGGGCCGCACGCTGCTTTGTCTCGCCGGCCTCTGGCTGCCGGGCCGCCTGATCGGTTTCGTGGGGGCGGATACGTGGAGCCTGCTGGCGGGCTTTTTTGATCTGGCGTTTCTGCTCGCGCTCTCCGTCCTTATCGGCAAGGCGATGCTGGTGCGGCGAACGACGAAACATCTGGCGTTCCTCGTCTGGCTCATTCTGTTTGCGGCGGCGGAGACGGGCGTGCGCTACGCCTGGTGGATGGGTGATCTGGAATTCGCGGTCCGCTGT...CTGGAGGCGGCGCTGTGCATCTTCATCGTGCTTTTCTCGCTCTCGGCCGCGCGCATCAACGTCGTCGTCATCAATCTGGCGCTCGATCCAAGCGGCGAGACCACGCCTTACCGGCCACATCCCGGACGCCAGCATATGGCG---GGTGCCATGGTGACGCTGTACATGGCAGCAAAA---------CTTCTGTTTCCGGAAAGCGACGTCTGCGCCTGGCTGGCGCTTGCGGCCGGTGCCGCGTTTTTCGACCGGCTGGCCGAATGGTTCATCGGCCGCGCCGTCTTCAGGACCGAGGTCCTGTTGCTGGCGCTCGGCAATGCCTTTGCCGGGGCGGGATTTCTGGCGCTCGGGGCGACGCGG------CTCGGCTTTTCCGTTACGTCTGCCGCAGGGCTGCACCTGCTGTCGGTCGGCGCGCTTGGCTGCGCCATTATGGCCGTCTTCATCATTGCCGGGCTACGGCACACCGGACGCGATCTGAAACATCTGCCC...TGGCAGGCGCATGCAGCGGCTGCCCTGATGGTGATGGCAGGGCTCACCCGTATCCTGCCCGAATTCGATGTCGCAGCAGTCCTGTCACCCTATCATCACGGCCTCAGTGCTATCCTGTGGGCTGCGAGTTTCGGCATCTGGCTTCAGGGCTTCCTGCCCTTCATGCGCGCGCCTGGCACC
TRN  10010101100011000
//