EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05933 - Fun_ATP-synt_8)
FAM  PF05933
PID  Fun_ATP-synt_8
DES  Fungal ATP synthase protein 8 (A6L)
IPR  IPR009230
ANO  18
ALN  48
AID  0.454368
APH  (((ATP8_NEUCR/1-48:0.08276,Q8HHC9_CRYPA/1-48:0.16720):0.00000,(Q8HG52_9HYPO/1-48:0.24665,Q8SHQ8_TRIRE/3-50:0.13432):0.16457):0.18094,((ATP8_EMENI/1-48:0.10660,ATP8_ASPAM/1-48:0.12206):0.18090,(ATP8_TRIRU/1-48:0.44450,Q94ZJ7_SCHCO/1-48:0.39784):0.12569):0.10481,((((Q37398_ALLMA/1-47:1.19045,Q950M5_9FUNG/1-48:0.77731):0.51020,(Q9B8D3_CANAL/1-48:0.23537,ATP8_CANPA/1-48:0.18911):0.16618):0.36165,(ATP8_YEAST/1-48:0.22260,ATP8_KLULA/1-48:0.02721):0.14474):0.24026,((Q8HMY8_SCHJP/1-48:0.64857,(ATP8_SCHPO/1-48:0.00000,Q8HQ91_SCHOT/1-48:0.30750):0.36351):0.20714,ATP8_YARLI/1-48:0.41443):0.06265):0.08081);
ATP  (((ATP8_NEUCR/1-48,Q8HHC9_CRYPA/1-48),(Q8HG52_9HYPO/1-48,Q8SHQ8_TRIRE/3-50)),((ATP8_EMENI/1-48,ATP8_ASPAM/1-48),(ATP8_TRIRU/1-48,Q94ZJ7_SCHCO/1-48)),((((Q37398_ALLMA/1-47,Q950M5_9FUNG/1-48),(Q9B8D3_CANAL/1-48,ATP8_CANPA/1-48)),(ATP8_YEAST/1-48,ATP8_KLULA/1-48)),((Q8HMY8_SCHJP/1-48,(ATP8_SCHPO/1-48,Q8HQ91_SCHOT/1-48)),ATP8_YARLI/1-48)));
ATL  8.60853
DNO  17
DLN  144
DID  0.591893
DPH  (Q94ZJ7_SCHCO/1-48:0.28153,(((ATP8_TRIRU/1-48:0.24653,ATP8_EMENI/1-48:0.08843):0.13006,((Q8SHQ8_TRIRE/3-50:0.08587,Q8HG52_9HYPO/1-48:0.21715):0.09785,(Q8HHC9_CRYPA/1-48:0.06525,ATP8_NEUCR/1-48:0.12098):0.10901):0.07340):0.07066,((ATP8_KLULA/1-48:0.08920,ATP8_YEAST/1-48:0.13954):0.12822,(((ATP8_CANPA/1-48:0.11483,Q9B8D3_CANAL/1-48:0.23727):0.14874,(Q950M5_9FUNG/1-48:0.43050,Q37398_ALLMA/1-47:0.42370):0.12514):0.11517,((Q8HQ91_SCHOT/1-48:0.14251,ATP8_SCHPO/1-48:0.13717):0.13650,Q8HMY8_SCHJP/1-48:0.28978):0.06597):0.10680):0.01752):0.11275,ATP8_YARLI/1-48:0.20305);
DTP  (Q94ZJ7_SCHCO/1-48,(((ATP8_TRIRU/1-48,ATP8_EMENI/1-48),((Q8SHQ8_TRIRE/3-50,Q8HG52_9HYPO/1-48),(Q8HHC9_CRYPA/1-48,ATP8_NEUCR/1-48))),((ATP8_KLULA/1-48,ATP8_YEAST/1-48),(((ATP8_CANPA/1-48,Q9B8D3_CANAL/1-48),(Q950M5_9FUNG/1-48,Q37398_ALLMA/1-47)),((Q8HQ91_SCHOT/1-48,ATP8_SCHPO/1-48),Q8HMY8_SCHJP/1-48)))),ATP8_YARLI/1-48);
DTL  4.75108
RID  0.453639
RPH  (((((((ATP8_NEUCR/1-48:0.04546,Q950M5_9FUNG/1-48:1.08675):0.04022,Q8HHC9_CRYPA/1-48:0.16363):0.00000,(Q8SHQ8_TRIRE/3-50:0.13382,Q8HG52_9HYPO/1-48:0.24692):0.16480):0.22166,(ATP8_TRIRU/1-48:0.48653,ATP8_EMENI/1-48:0.19698):0.17307):0.00000,(Q94ZJ7_SCHCO/1-48:0.13437,Q37398_ALLMA/1-47:1.28452):0.35418):0.06267,((ATP8_KLULA/1-48:0.01105,ATP8_YEAST/1-48:0.23822):0.14618,(ATP8_CANPA/1-48:0.18016,Q9B8D3_CANAL/1-48:0.23658):0.49164):0.24390):0.06191,((Q8HQ91_SCHOT/1-48:0.30724,ATP8_SCHPO/1-48:0.00000):0.39125,Q8HMY8_SCHJP/1-48:0.62261):0.20303,ATP8_YARLI/1-48:0.39983);
RTP  (((((((ATP8_NEUCR/1-48,Q950M5_9FUNG/1-48),Q8HHC9_CRYPA/1-48),(Q8SHQ8_TRIRE/3-50,Q8HG52_9HYPO/1-48)),(ATP8_TRIRU/1-48,ATP8_EMENI/1-48)),(Q94ZJ7_SCHCO/1-48,Q37398_ALLMA/1-47)),((ATP8_KLULA/1-48,ATP8_YEAST/1-48),(ATP8_CANPA/1-48,Q9B8D3_CANAL/1-48))),((Q8HQ91_SCHOT/1-48,ATP8_SCHPO/1-48),Q8HMY8_SCHJP/1-48),ATP8_YARLI/1-48);
RTL  8.32918
LNK  ATP8_ASPAM/1-48:P00858:
LNK  ATP8_CANPA/1-48:P17345:X52115
LNK  ATP8_EMENI/1-48:P00857:J01390
LNK  ATP8_KLULA/1-48:Q00608:X57546
LNK  ATP8_NEUCR/1-48:Q08656:L14642
LNK  ATP8_SCHPO/1-48:P21536:X54421
LNK  ATP8_TRIRU/1-48:Q36838:X88896
LNK  ATP8_YARLI/1-48:Q36257:AJ307410
LNK  ATP8_YEAST/1-48:P00856:X00895
LNK  Q37398_ALLMA/1-47:Q37398:U41288
LNK  Q8HG52_9HYPO/1-48:Q8HG52:AF487277
LNK  Q8HHC9_CRYPA/1-48:Q8HHC9:AF456838
LNK  Q8HMY8_SCHJP/1-48:Q8HMY8:AF547983
LNK  Q8HQ91_SCHOT/1-48:Q8HQ91:AF275271
LNK  Q8SHQ8_TRIRE/3-50:Q8SHQ8:AF447590
LNK  Q94ZJ7_SCHCO/1-48:Q94ZJ7:AF402141
LNK  Q950M5_9FUNG/1-48:Q950M5:AF404306
LNK  Q9B8D3_CANAL/1-48:Q9B8D3:AF285261
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ATP8_YARLI/1-48
ASQ  MPQLVPFYFTNQIFYGFASLSVIVYLFSIYILPHYLEIYVTRIFITKT
DSQ  ATGCCTCAATTAGTACCTTTTTACTTCACTAATCAAATATTTTATGGTTTCGCTTCATTAAGCGTAATTGTATACTTATTTTCAATATATATCTTACCACACTATCTAGAGATATATGTTACAAGAATATTTATTACTAAAACA
TRN  10010101110011000
NAM  ATP8_KLULA/1-48
ASQ  MPQLVPFYFLNQLVYGFALVTILLVLFAQYFLPQILRLYVSRLFISKL
DSQ  ATGCCACAATTAGTACCATTTTATTTCTTAAATCAATTAGTATATGGTTTTGCATTAGTTACTATTTTATTAGTATTATTTGCACAATACTTCTTACCACAAATTTTAAGATTATATGTATCAAGATTATTTATTTCAAAATTA
TRN  10110101110011000
NAM  ATP8_YEAST/1-48
ASQ  MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL
DSQ  ATGCCACAATTAGTTCCATTTTATTTTATGAATCAATTAACATATGGTTTCTTATTAATGATTCTATTATTAATTTTATTCTCACAATTCTTTTTACCTATGATCTTAAGATTATATGTATCTAGATTATTTATTTCTAAATTA
TRN  00100000000000000
NAM  ATP8_CANPA/1-48
ASQ  MPQLVPFYFMNLLTGGILAISLLLYFVATYLLPNILRLLIARNIIIKL
DSQ  ATGCCTCAATTAGTTCCTTTTTACTTTATGAATTTATTAACAGGTGGTATTTTAGCTATTTCATTATTATTATACTTTGTAGCTACTTATTTATTACCTAATATTCTTCGTTTATTAATTGCTCGTAATATTATAATTAAATTA
TRN  10010101110011000
NAM  Q9B8D3_CANAL/1-48
ASQ  MPQLVPFYWMNLLTTGIAAVSILLYLSATIILPNVLRLLVARAIIVRV
DSQ  ATGCCACAATTAGTTCCTTTTTATTGAATGAATTTATTAACTACAGGTATTGCAGCTGTATCAATATTATTATATTTAAGTGCTACTATAATATTACCAAATGTATTACGTTTATTAGTAGCTAGAGCTATAATAGTACGTGTA
TRN  00010000000000000
NAM  Q8HQ91_SCHOT/1-48
ASQ  MPQLNPLYFLNILSFGFVIFSILLYVSSVYILPRYTELYISRSIFTSL
DSQ  ATGCCACAATTAAATCCATTATACTTTTTAAATATTTTATCATTTGGTTTTGTAATTTTCAGTATCTTATTATATGTATCATCAGTATATATTTTACCAAGATATACAGAATTATATATCAGTAGATCAATTTTTACATCACTT
TRN  10010101110011000
NAM  ATP8_SCHPO/1-48
ASQ  MPQLVPFYFINILSFGFLIFTVLLYISSVYVLPRYNELFISRSIISSL
DSQ  ATGCCACAATTAGTACCATTCTATTTTATTAATATTTTATCTTTTGGTTTTTTAATCTTTACTGTTTTATTATATATTTCATCAGTATATGTATTACCAAGATATAATGAATTATTTATCTCAAGATCTATTATAAGTTCTTTA
TRN  10010101110011000
NAM  Q94ZJ7_SCHCO/1-48
ASQ  MPQLIPFYFLNQIVFTFVTLFLVVYLLSKYFLPLFTYLQVIRNYITKL
DSQ  ATGCCACAATTAATACCTTTTTACTTCTTAAATCAAATTGTATTTACATTCGTTACACTATTCTTAGTAGTTTATCTACTATCTAAATACTTCTTACCTTTATTCACATATTTACAAGTGATTAGAAATTATATTACTAAATTA
TRN  10010101110011010
NAM  Q8SHQ8_TRIRE/3-50
ASQ  MPQLTPFYYMNEIVFAFAIIVILLFILSKYILPRIVRLFLSRMFINKI
DSQ  ATGCCACAATTAACACCTTTTTATTATATGAACGAAATAGTATTTGCTTTTGCAATAATAGTAATACTATTATTCATACTATCTAAATACATACTACCAAGAATAGTACGTTTATTTTTATCACGTATGTTTATTAATAAAATA
TRN  10010101110011000
NAM  Q8HG52_9HYPO/1-48
ASQ  MPHLTPFYYVTDIVFTFAIIVIVLYISSKYISPWLVRFFLSRMFISAL
DSQ  ATGCCTCACTTAACACCTTTTTACTATGTGACTGACATAGTGTTTACTTTCGCAATCATTGTAATAGTATTATATATCTCCTCTAAATATATTTCACCCTGACTCGTTCGTTTTTTCTTATCACGTATGTTTATTAGTGCTCTA
TRN  00010000000000000
NAM  Q8HHC9_CRYPA/1-48
ASQ  MPQLVPFYFINEVIFTFAVIAITVYMMSKYILPRFVRLFLSRTFISKL
DSQ  ATGCCACAATTAGTTCCTTTTTATTTTATAAATGAAGTAATATTTACTTTTGCCGTTATAGCTATTACAGTGTATATGATGTCAAAATATATTTTACCTAGATTTGTACGTTTATTCTTATCACGTACTTTTATTTCAAAACTT
TRN  10010101110011000
NAM  ATP8_NEUCR/1-48
ASQ  MPQLVPFYFVNEITFTFVIITLMVYILSKYILPRFVRLFLSRTFISKL
DSQ  ATGCCTCAATTAGTTCCATTTTATTTTGTTAATGAAATAACTTTTACTTTTGTAATAATAACTCTTATGGTTTATATTTTATCTAAATATATTTTACCTAGATTTGTTCGTTTATTCTTATCTCGTACTTTTATATCAAAACTT
TRN  10010101110011000
NAM  ATP8_TRIRU/1-48
ASQ  MPQLIPFFFFNQVVFTLISLSFIFFVFSKYILPWIVRLYVSRNQYNSL
DSQ  ATGCCACAATTAATACCATTTTTTTTCTTTAATCAAGTAGTTTTTACATTAATATCATTAAGTTTTATATTCTTTGTATTTAGTAAATATATTTTACCTTGAATAGTAAGATTATATGTTTCACGAAATCAATATAATAGTTTA
TRN  00010000000000000
NAM  ATP8_ASPAM/1-48
ASQ  MPQLVPFFFVNQVVYAFVILTVLIYAFTKFILPKFVRIFISRIYINKL
NAM  ATP8_EMENI/1-48
ASQ  MPQLVPFFFVNQVVFAFIVLTVLIYAFSKYILPRLLRTYISRIYINKL
DSQ  ATGCCACAACTAGTACCATTCTTTTTTGTAAATCAAGTAGTATTTGCATTTATAGTATTAACTGTATTAATCTATGCATTTAGTAAATATATATTACCTAGATTATTACGTACATATATATCACGTATATATATAAATAAATTA
TRN  10010101110011000
NAM  Q8HMY8_SCHJP/1-48
ASQ  MPQLLPFYIKHMILVGFLVLIILIYLISKYFLPRLNELYIARYKLSET
DSQ  ATGCCACAATTATTACCATTTTACATTAAACATATGATTTTAGTTGGTTTCTTAGTGCTAATAATATTAATCTATTTAATATCTAAATATTTTTTACCTAGATTAAATGAATTATATATAGCAAGATATAAATTATCAGAAACT
TRN  10010101110011000
NAM  Q950M5_9FUNG/1-48
ASQ  MPQFSPLWFINIISWTFAIISFLVWYNQAIILPSIVRLNLSRTIMLFN
DSQ  ATGCCACAATTCTCACCATTATGGTTTATTAATATTATATCTTGGACTTTTGCTATTATTTCATTCTTAGTTTGGTATAATCAAGCTATTATTTTACCATCAATTGTTCGTTTAAATTTAAGTAGAACAATTATGTTATTTAAC
TRN  10010101110011000
NAM  Q37398_ALLMA/1-47
ASQ  MPQLEPLYFINSISWTYLAFGITFVLVSKVFLPLNLKTQMIRLTLIQ-
DSQ  ATGCCACAATTAGAACCATTATATTTTATTAATTCAATTTCATGGACTTATTTAGCTTTTGGGATAACATTTGTACTTGTATCAAAAGTATTTCTTCCTTTAAATCTTAAAACACAAATGATCAGATTAACTTTAATTCAG---
TRN  10010101110011000
//