EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05931 - AgrD)
FAM  PF05931
PID  AgrD
DES  Staphylococcal AgrD protein
IPR  IPR009229
ANO  19
ALN  45
AID  0.439363
APH  ((((((((((Q8VSY5_9STAP/1-45:0.26649,((Q8VSW3_STAXY/1-45:0.09169,Q8VSY2_STAGA/1-45:0.32125):0.04682,Q8VSY8_9STAP/1-45:0.24933):0.16186):0.32305,Q8VT12_9STAP/1-45:0.13022):0.34537,(O68160_STAEP/2-46:0.19670,Q8VT00_STACP/4-48:0.25943):0.00000):0.08865,Q8VSX3_STAEP/2-46:0.50756):0.17269,Q54338_STALU/2-46:0.67653):0.06967,(O33586_STAAU/2-46:0.52886,(O33589_STAAU/2-46:0.66633,Q53643_STAAU/2-46:0.03616):0.28662):0.11446):0.27485,(Q8VSZ4_9STAP/4-48:0.25451,Q8VSZ7_9STAP/2-46:0.08218):0.10791):0.18983,(Q8VT06_9STAP/1-45:0.65622,Q8VSX9_STAIN/1-45:0.41342):0.18910):0.31103,Q8VSZ1_STACA/1-45:0.11356):0.07381,Q8VSW9_STASI/1-45:0.11831,Q8VSX1_STASI/1-45:0.11398);
ATP  ((((((((((Q8VSY5_9STAP/1-45,((Q8VSW3_STAXY/1-45,Q8VSY2_STAGA/1-45),Q8VSY8_9STAP/1-45)),Q8VT12_9STAP/1-45),(O68160_STAEP/2-46,Q8VT00_STACP/4-48)),Q8VSX3_STAEP/2-46),Q54338_STALU/2-46),(O33586_STAAU/2-46,(O33589_STAAU/2-46,Q53643_STAAU/2-46))),(Q8VSZ4_9STAP/4-48,Q8VSZ7_9STAP/2-46)),(Q8VT06_9STAP/1-45,Q8VSX9_STAIN/1-45)),Q8VSZ1_STACA/1-45),Q8VSW9_STASI/1-45,Q8VSX1_STASI/1-45);
ATL  8.6497
DNO  19
DLN  135
DID  0.577388
DPH  (((((((((Q54338_STALU/2-46:0.37054,(Q8VSZ4_9STAP/4-48:0.11629,Q8VSZ7_9STAP/2-46:0.09471):0.13496):0.08570,(O33589_STAAU/2-46:0.22925,Q53643_STAAU/2-46:0.08901):0.16636):0.11244,((Q8VT00_STACP/4-48:0.19874,Q8VSX3_STAEP/2-46:0.33397):0.07507,O68160_STAEP/2-46:0.16729):0.06969):0.08943,O33586_STAAU/2-46:0.38990):0.04823,Q8VT12_9STAP/1-45:0.10769):0.07367,(((Q8VSW3_STAXY/1-45:0.10435,Q8VSY2_STAGA/1-45:0.18537):0.02856,Q8VSY8_9STAP/1-45:0.22401):0.09049,Q8VSY5_9STAP/1-45:0.20111):0.04861):0.19319,(Q8VSX9_STAIN/1-45:0.23747,Q8VT06_9STAP/1-45:0.40877):0.07216):0.22199,Q8VSZ1_STACA/1-45:0.00000):0.17128,Q8VSW9_STASI/1-45:0.05085,Q8VSX1_STASI/1-45:0.09914);
DTP  (((((((((Q54338_STALU/2-46,(Q8VSZ4_9STAP/4-48,Q8VSZ7_9STAP/2-46)),(O33589_STAAU/2-46,Q53643_STAAU/2-46)),((Q8VT00_STACP/4-48,Q8VSX3_STAEP/2-46),O68160_STAEP/2-46)),O33586_STAAU/2-46),Q8VT12_9STAP/1-45),(((Q8VSW3_STAXY/1-45,Q8VSY2_STAGA/1-45),Q8VSY8_9STAP/1-45),Q8VSY5_9STAP/1-45)),(Q8VSX9_STAIN/1-45,Q8VT06_9STAP/1-45)),Q8VSZ1_STACA/1-45),Q8VSW9_STASI/1-45,Q8VSX1_STASI/1-45);
DTL  5.19792
RID  0.439363
RPH  ((((((((((Q8VSY5_9STAP/1-45:0.26649,((Q8VSW3_STAXY/1-45:0.09169,Q8VSY2_STAGA/1-45:0.32125):0.04682,Q8VSY8_9STAP/1-45:0.24933):0.16186):0.32305,Q8VT12_9STAP/1-45:0.13022):0.34537,(O68160_STAEP/2-46:0.19670,Q8VT00_STACP/4-48:0.25943):0.00000):0.08865,Q8VSX3_STAEP/2-46:0.50756):0.17269,Q54338_STALU/2-46:0.67653):0.06967,(O33586_STAAU/2-46:0.52886,(O33589_STAAU/2-46:0.66633,Q53643_STAAU/2-46:0.03616):0.28662):0.11446):0.27485,(Q8VSZ4_9STAP/4-48:0.25451,Q8VSZ7_9STAP/2-46:0.08218):0.10791):0.18983,(Q8VT06_9STAP/1-45:0.65622,Q8VSX9_STAIN/1-45:0.41342):0.18910):0.31103,Q8VSZ1_STACA/1-45:0.11356):0.07381,Q8VSW9_STASI/1-45:0.11831,Q8VSX1_STASI/1-45:0.11398);
RTP  ((((((((((Q8VSY5_9STAP/1-45,((Q8VSW3_STAXY/1-45,Q8VSY2_STAGA/1-45),Q8VSY8_9STAP/1-45)),Q8VT12_9STAP/1-45),(O68160_STAEP/2-46,Q8VT00_STACP/4-48)),Q8VSX3_STAEP/2-46),Q54338_STALU/2-46),(O33586_STAAU/2-46,(O33589_STAAU/2-46,Q53643_STAAU/2-46))),(Q8VSZ4_9STAP/4-48,Q8VSZ7_9STAP/2-46)),(Q8VT06_9STAP/1-45,Q8VSX9_STAIN/1-45)),Q8VSZ1_STACA/1-45),Q8VSW9_STASI/1-45,Q8VSX1_STASI/1-45);
RTL  8.6497
LNK  O33586_STAAU/2-46:O33586:AF001782
LNK  O33589_STAAU/2-46:O33589:AF001783
LNK  O68160_STAEP/2-46:O68160:AF012132
LNK  Q53643_STAAU/2-46:Q53643:X52543
LNK  Q54338_STALU/2-46:Q54338:L13334
LNK  Q8VSW3_STAXY/1-45:Q8VSW3:AF346729
LNK  Q8VSW9_STASI/1-45:Q8VSW9:AF346727
LNK  Q8VSX1_STASI/1-45:Q8VSX1:AF346726
LNK  Q8VSX3_STAEP/2-46:Q8VSX3:AF346725
LNK  Q8VSX9_STAIN/1-45:Q8VSX9:AF346723
LNK  Q8VSY2_STAGA/1-45:Q8VSY2:AF346722
LNK  Q8VSY5_9STAP/1-45:Q8VSY5:AF346721
LNK  Q8VSY8_9STAP/1-45:Q8VSY8:AF346720
LNK  Q8VSZ1_STACA/1-45:Q8VSZ1:AF346719
LNK  Q8VSZ4_9STAP/4-48:Q8VSZ4:AF346718
LNK  Q8VSZ7_9STAP/2-46:Q8VSZ7:AF346717
LNK  Q8VT00_STACP/4-48:Q8VT00:AF346716
LNK  Q8VT06_9STAP/1-45:Q8VT06:AF346714
LNK  Q8VT12_9STAP/1-45:Q8VT12:AF346712
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8VT12_9STAP/1-45
ASQ  MNLLNSFFSFFAKFFELIGTVAGVNPCGGWFDEPEVPEELTKLSE
DSQ  ATGAACTTATTAAATTCATTTTTCAGTTTTTTCGCCAAGTTTTTCGAGTTAATCGGTACAGTCGCAGGTGTTAATCCTTGTGGTGGTTGGTTTGACGAACCTGAAGTTCCAGAAGAATTAACAAAATTATCCGAA
TRN  11111101111011000
NAM  Q8VT00_STACP/4-48
ASQ  DALFNLVLKFFTIIFEFIGFVAGANPCALYYDEPEVPDELSKLYE
DSQ  GATGCTTTATTCAATTTAGTTCTCAAATTTTTTACTATCATATTTGAATTTATTGGTTTTGTAGCTGGTGCTAACCCTTGTGCTCTATACTACGATGAGCCAGAAGTACCTGATGAATTATCAAAGCTTTATGAA
TRN  10010101110011000
NAM  O68160_STAEP/2-46
ASQ  EIIFNLFIKFFTTILEFIGTVAGDSVCASYFDEPEVPEELTKLYE
DSQ  GAAATCATTTTTAATTTATTTATAAAATTTTTCACTACAATCTTGGAATTTATTGGTACTGTAGCAGGAGATAGTGTATGTGCCTCTTACTTTGACGAACCAGAAGTACCAGAAGAACTGACTAAACTATACGAG
TRN  10010101100011010
NAM  Q8VSX3_STAEP/2-46
ASQ  NLLGGLLLKLFSNFMAVIGNAAKYNPCASYLDEPQVPEELTKLDE
DSQ  AATTTATTAGGTGGCTTACTTTTAAAATTATTTTCTAACTTTATGGCAGTAATTGGTAACGCAGCAAAATACAACCCTTGTGCTAGTTATCTCGATGAGCCACAAGTGCCAGAAGAATTAACTAAACTCGATGAG
TRN  11011101111011010
NAM  Q8VSZ7_9STAP/2-46
ASQ  MQIINLLFKVITAVFEKIGFIAGYSTCSYYFDEPEVPKELLEIYK
DSQ  ATGCAAATTATTAATTTACTATTTAAAGTGATCACTGCTGTTTTTGAAAAAATTGGCTTTATAGCTGGTTATAGTACTTGTAGTTACTATTTTGATGAACCTGAAGTACCAAAAGAACTACTTGAAATATACAAA
TRN  10010101110011010
NAM  Q8VSZ4_9STAP/4-48
ASQ  MQIFDLLFKVISFIFEKIGFLAGYRTCNTYFDEPEVPKELFETYQ
DSQ  ATGCAAATTTTCGATTTATTATTTAAAGTTATTAGTTTTATTTTTGAAAAAATTGGTTTTTTAGCTGGTTACAGAACATGTAATACTTATTTTGATGAACCTGAAGTACCTAAAGAATTATTTGAAACATACCAA
TRN  10110101110011010
NAM  Q8VSZ1_STACA/1-45
ASQ  MDILNGIFKFFAFIFEQIGNIAKYNPCVGYFDEPEVPSELLDEQK
DSQ  ATGGACATTTTAAATGGTATTTTTAAATTTTTCGCTTTTATCTTTGAACAAATCGGTAACATTGCTAAATACAATCCTTGTGTTGGATATTTCGATGAACCAGAAGTACCTAGCGAATTATTAGACGAACAAAAA
TRN  11111101111011010
NAM  Q8VSX1_STASI/1-45
ASQ  MDLLNGIFKLFAFIFEKIGNLAKYNPCLGFLDEPTVPKELLEEDK
DSQ  ATGGACTTATTAAATGGTATCTTTAAATTATTCGCTTTTATCTTTGAGAAAATTGGAAACTTAGCTAAGTATAACCCATGCCTAGGGTTTTTAGATGAACCAACTGTACCGAAAGAATTATTAGAAGAAGACAAA
TRN  11011101111011010
NAM  Q8VSW9_STASI/1-45
ASQ  MELLNGIFKLFAFIFEKIGNLAKYYPCFGYFDESEVPQELLDEDK
DSQ  ATGGAATTATTAAATGGTATCTTTAAATTATTCGCTTTTATCTTTGAGAAAATTGGAAACTTAGCTAAGTATTATCCTTGCTTTGGATATTTTGATGAATCAGAAGTACCACAAGAGTTATTAGACGAAGATAAA
TRN  11111101111011000
NAM  Q54338_STALU/2-46
ASQ  NLLSGLFTKGISAIFEFIGNFSAQDICNAYFDEPEVPQELIDLQR
DSQ  AACTTATTAAGCGGATTATTTACAAAAGGGATTAGTGCAATTTTTGAATTTATCGGAAACTTTTCTGCTCAAGATATTTGTAACGCTTATTTTGATGAGCCAGAAGTACCACAAGAATTAATTGATTTACAAAGA
TRN  10110101110011010
NAM  Q8VSY8_9STAP/1-45
ASQ  MHIFESIINLFVKFFSVLGAVSGGKVCSAYFDEPEVPKEITDLYK
DSQ  ATGCATATTTTTGAATCTATTATAAACTTATTCGTTAAATTTTTTAGTGTTTTAGGAGCAGTTTCAGGTGGAAAAGTTTGCAGTGCTTATTTTGATGAACCTGAGGTACCAAAAGAAATTACAGATTTATACAAA
TRN  10010101110011000
NAM  Q8VSY2_STAGA/1-45
ASQ  MNILDSLLNLATKFFSALGASVGARPCGGFFDEPEVPAEITELHK
DSQ  ATGAATATTTTAGATTCTTTATTAAATTTAGCTACTAAATTCTTTTCAGCATTAGGTGCTTCAGTTGGTGCTAGACCATGTGGCGGTTTCTTTGATGAGCCAGAAGTACCAGCAGAAATAACAGAATTACACAAA
TRN  10010101110011000
NAM  Q8VSW3_STAXY/1-45
ASQ  MNIFESILNLFAKFFSVLGVMAGAKPCGGFFDEPEVPSEITKLYE
DSQ  ATGAATATTTTCGAATCTATTTTAAACTTATTTGCTAAATTTTTCTCAGTACTAGGTGTGATGGCAGGAGCAAAACCTTGTGGTGGCTTTTTTGATGAGCCTGAAGTACCATCAGAAATAACTAAATTGTACGAA
TRN  10010101110011000
NAM  Q8VSY5_9STAP/1-45
ASQ  MNIFESILTVFAKFFAFIGTISSVKPCTGFADEPEIPKELTDLYK
DSQ  ATGAATATTTTCGAATCAATTTTAACTGTTTTTGCTAAGTTCTTTGCTTTTATTGGTACTATTTCAAGTGTTAAACCTTGTACAGGTTTTGCTGATGAACCTGAGATTCCTAAAGAGTTAACAGATTTATATAAA
TRN  11111101111011000
NAM  Q8VSX9_STAIN/1-45
ASQ  MRILEVLFNLITNLFQSIGTFARIPTSTGFFDEPEIPAELLEEEK
DSQ  ATGAGAATTTTAGAAGTTTTATTCAACCTTATTACAAATTTATTCCAATCAATCGGTACTTTTGCTAGAATCCCAACGAGTACTGGATTTTTCGATGAACCAGAAATCCCTGCTGAGTTGTTAGAAGAGGAAAAA
TRN  10010101110011000
NAM  Q8VT06_9STAP/1-45
ASQ  MKLLDLLLSSTTSFLQMVGNRSKTKTCTVLYDEPEVPKELIQELE
DSQ  ATGAAATTATTAGATCTTTTACTCAGTTCAACAACTAGCTTTTTACAAATGGTAGGCAACAGATCAAAAACAAAAACTTGCACAGTTTTATACGATGAACCAGAAGTACCTAAAGAATTAATTCAAGAATTAGAA
TRN  10010101110011000
NAM  Q53643_STAAU/2-46
ASQ  NTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE
DSQ  AATACATTATTTAACTTATTTTTTGATTTTATTACTGGGATTTTAAAAAACATTGGTAACATCGCAGCTTATAGTACTTGTGACTTCATAATGGATGAAGTTGAAGTACCAAAAGAATTAACACAATTACACGAA
TRN  10010101110011010
NAM  O33589_STAAU/2-46
ASQ  KKLLNKVIELLVDFFNSIGYRAAYINCDFLLDEAEVPKELTQLHE
DSQ  AAAAAATTACTCAACAAAGTTATTGAGCTTTTAGTTGACTTTTTCAACAGCATCGGTTACAGAGCAGCCTATATAAATTGTGATTTTTTATTGGATGAAGCTGAAGTACCAAAAGAATTAACTCAATTACACGAA
TRN  10010101110011010
NAM  O33586_STAAU/2-46
ASQ  NTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYD
DSQ  AATACACTTGTTAATATGTTTTTTGATTTTATAATTAAATTAGCTAAAGCAATCGGAATTGTCGGTGGCGTAAACGCTTGCAGCAGTTTATTTGATGAACCTAAAGTACCCGCTGAATTAACGAATTTATACGAC
TRN  10010101110011010
//