EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05902 - 4_1_CTD)
FAM  PF05902
PID  4_1_CTD
DES  4.1 protein C-terminal domain (CTD)
IPR  IPR008379
ANO  6
ALN  116
AID  0.576089
APH  ((Q9JMB2_RAT/843-956:0.07325,41_HUMAN/747-861:0.13607):0.02007,(E41L2_HUMAN/886-999:0.05463,(Q8MLI7_DROME/622-699:0.12843,O18673_CAEEL/4453-4530:0.30282):0.68915):0.07607,E41L1_HUMAN/777-869:0.46940);
ATP  ((Q9JMB2_RAT/843-956,41_HUMAN/747-861),(E41L2_HUMAN/886-999,(Q8MLI7_DROME/622-699,O18673_CAEEL/4453-4530)),E41L1_HUMAN/777-869);
ATL  1.94989
DNO  5
DLN  348
DID  0.598641
DPH  (Q9JMB2_RAT/843-956:0.16217,((O18673_CAEEL/4453-4530:0.24493,Q8MLI7_DROME/622-699:0.27280):0.45800,41_HUMAN/747-861:0.13200):0.07391,E41L2_HUMAN/886-999:0.16181);
DTP  (Q9JMB2_RAT/843-956,((O18673_CAEEL/4453-4530,Q8MLI7_DROME/622-699),41_HUMAN/747-861),E41L2_HUMAN/886-999);
DTL  1.50562
RID  0.59437
RPH  (Q9JMB2_RAT/843-956:0.07041,41_HUMAN/747-861:0.13634,((O18673_CAEEL/4453-4530:0.30726,Q8MLI7_DROME/622-699:0.12813):0.69909,E41L2_HUMAN/886-999:0.05233):0.10543);
RTP  (Q9JMB2_RAT/843-956,41_HUMAN/747-861,((O18673_CAEEL/4453-4530,Q8MLI7_DROME/622-699),E41L2_HUMAN/886-999));
RTL  1.49899
LNK  41_HUMAN/747-861:P11171:AF156225
LNK  E41L1_HUMAN/777-869:Q9H4G0:
LNK  E41L2_HUMAN/886-999:O43491:AF027299
LNK  O18673_CAEEL/4453-4530:O18673:Z81499
LNK  Q8MLI7_DROME/622-699:Q8MLI7:AE003796
LNK  Q9JMB2_RAT/843-956:Q9JMB2:AB032828
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  E41L1_HUMAN/777-869
ASQ  ATEIRSLS-PIIGKDVLTSTY------.--------------GATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDED.VDQDQALALAIKEAKLQHPDMLVTKAVVYRETDP
NAM  Q9JMB2_RAT/843-956
ASQ  KLETSTKEVPVVHTETKTITYESSQVD.PGADLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDAD.IDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
DSQ  AAGCTAGAGACCTCTACCAAGGAGGTGCCAGTGGTCCACACAGAGACGAAAACCATCACGTACGAGTCTTCTCAGGTCGAT...CCTGGGGCAGATCTGGAGCCAGGTGTGCTAATGAGCGCCCAAACGATCACGTCTGAAACCACGAGTACTACCACCACCACACATATCACCAAAACTGTGAAAGGAGGCATTTCGGAGACGAGGATTGAGAAGCGAATAGTCATCACGGGAGATGCCGAC...ATTGACCATGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCCGACATGTCAGTAACCAAAGTAGTGGTCCATAAAGAGACAGAAATC
TRN  10010101100011001
NAM  41_HUMAN/747-861
ASQ  KSEIPTKDVPIVHTETKTITYEAAQTDdNSGDLDPGVLLTAQTITSETPSSTTTTKITKTVKGGISETRIEKRIVITGDAD.IDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEI
DSQ  AAAAGTGAAATCCCAACCAAAGACGTCCCTATTGTCCACACTGAGACCAAGACCATCACTTATGAGGCTGCCCAGACTGACgacAACAGTGGAGACTTGGACCCAGGAGTCTTGCTGACAGCTCAAACTATCACATCTGAGACCCCAAGCAGCACCACCACAACTCAAATTACCAAGACTGTAAAAGGTGGGATTTCAGAGACACGTATTGAAAAGAGAATTGTGATCACAGGAGATGCTGAT...ATTGACCATGATCAGGTCCTTGTACAAGCCATCAAGGAGGCAAAGGAGCAGCACCCAGACATGTCAGTGACCAAGGTGGTCGTCCACCAGGAGACCGAGATT
TRN  10010101100011001
NAM  E41L2_HUMAN/886-999
ASQ  RTEISTKEVPIVQTETKTITYESPQID.GGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGD.IDHDQALAQAIREAREQHPDMSVTRVVVHKETEL
DSQ  AGGACAGAAATCTCCACCAAGGAAGTCCCCATTGTCCAAACTGAGACCAAAACCATCACATATGAGTCTCCACAGATTGAT...GGCGGGGCTGGTGGTGATTCGGGCACGTTACTGACCGCACAAACCATCACATCTGAGTCCGTGTCAACAACGACAACCACACACATCACCAAGACTGTAAAAGGTGGAATTTCTGAAACAAGAATTGAGAAACGCATTGTGATCACAGGAGATGGAGAT...ATTGATCATGACCAGGCACTGGCTCAGGCGATCAGGGAAGCCAGAGAGCAGCACCCTGACATGTCGGTCACAAGAGTGGTGGTACACAAAGAAACAGAGTTG
TRN  10010101100011000
NAM  Q8MLI7_DROME/622-699
ASQ  GEIISTQTVSSKTRTVETITY------.------------------------------KTERDGIVETRVEQKITIQSDGDpIDHDKALAEAIQEATAMNPDMTVEKIEIQQQTQ-
DSQ  GGCGAAATCATCTCCACCCAAACCGTGAGCAGCAAAACCCGCACTGTGGAAACCATTACCTAC------------------...------------------------------------------------------------------------------------------AAAACCGAACGCGATGGCATTGTGGAGACCCGAGTGGAACAGAAGATAACCATTCAGTCCGATGGAGATccgATCGATCATGACAAAGCCTTGGCCGAGGCAATACAAGAAGCGACGGCCATGAATCCGGACATGACAGTCGAGAAGATTGAAATTCAGCAGCAAACGCAG---
TRN  10010101110011011
NAM  O18673_CAEEL/4453-4530
ASQ  GEYVSSKSVTQGNRTIETITY------.------------------------------KTEKDGIVETHVEHRVTIHSDGD.IDHDAELSQAILEATQMNPDMVVEKIEVRQETTQ
DSQ  GGCGAGTACGTCTCATCGAAAAGTGTGACTCAGGGCAATCGAACGATCGAAACTATCACCTAC------------------...------------------------------------------------------------------------------------------AAGACGGAAAAAGACGGAATTGTTGAGACACACGTTGAGCATCGTGTCACCATTCACTCTGATGGCGAT...ATTGATCATGATGCAGAGCTCTCCCAAGCGATTCTCGAAGCCACCCAAATGAATCCAGATATGGTTGTTGAAAAGATTGAAGTTCGTCAGGAGACCACCCAA
TRN  11011101111011001
//