EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05896 - NQRA)
FAM  PF05896
PID  NQRA
DES  Na(+)-translocating NADH-quinone reductase subunit A (NQRA)
IPR  IPR008703
ANO  10
ALN  469
AID  0.499912
APH  (((NQRA_VIBAL/1-446:0.27104,(((NQRA_HAEIN/1-447:0.15251,Q44130_ACTPL/1-449:0.11851):0.05913,NQRA_PASMU/1-446:0.10916):0.06366,NQRA_NEIMA/1-447:0.21594):0.05575):0.05951,NQRA_YERPE/1-447:0.20557):0.04581,NQRA_PSEAE/1-445:0.34547,((NQRA_CHLPN/2-459:0.23408,NQRA_CHLMU/2-460:0.20940):0.79862,Q9X6S0_PORGI/4-450:0.69574):0.48793);
ATP  (((NQRA_VIBAL/1-446,(((NQRA_HAEIN/1-447,Q44130_ACTPL/1-449),NQRA_PASMU/1-446),NQRA_NEIMA/1-447)),NQRA_YERPE/1-447),NQRA_PSEAE/1-445,((NQRA_CHLPN/2-459,NQRA_CHLMU/2-460),Q9X6S0_PORGI/4-450));
ATL  4.12783
DNO  10
DLN  1407
DID  0.518296
DPH  (((NQRA_VIBAL/1-446:0.31050,((NQRA_HAEIN/1-447:0.17658,NQRA_PASMU/1-446:0.16626):0.05727,Q44130_ACTPL/1-449:0.14019):0.11181):0.08245,NQRA_NEIMA/1-447:0.21228):0.04513,(NQRA_PSEAE/1-445:0.38680,NQRA_YERPE/1-447:0.18462):0.04793,((NQRA_CHLPN/2-459:0.24533,NQRA_CHLMU/2-460:0.23323):0.63580,Q9X6S0_PORGI/4-450:0.47332):0.33926);
DTP  (((NQRA_VIBAL/1-446,((NQRA_HAEIN/1-447,NQRA_PASMU/1-446),Q44130_ACTPL/1-449)),NQRA_NEIMA/1-447),(NQRA_PSEAE/1-445,NQRA_YERPE/1-447),((NQRA_CHLPN/2-459,NQRA_CHLMU/2-460),Q9X6S0_PORGI/4-450));
DTL  3.84876
RID  0.499912
RPH  (((NQRA_VIBAL/1-446:0.27104,(((NQRA_HAEIN/1-447:0.15251,Q44130_ACTPL/1-449:0.11851):0.05913,NQRA_PASMU/1-446:0.10916):0.06366,NQRA_NEIMA/1-447:0.21594):0.05575):0.05951,NQRA_YERPE/1-447:0.20557):0.04581,NQRA_PSEAE/1-445:0.34547,((NQRA_CHLPN/2-459:0.23408,NQRA_CHLMU/2-460:0.20940):0.79862,Q9X6S0_PORGI/4-450:0.69574):0.48793);
RTP  (((NQRA_VIBAL/1-446,(((NQRA_HAEIN/1-447,Q44130_ACTPL/1-449),NQRA_PASMU/1-446),NQRA_NEIMA/1-447)),NQRA_YERPE/1-447),NQRA_PSEAE/1-445,((NQRA_CHLPN/2-459,NQRA_CHLMU/2-460),Q9X6S0_PORGI/4-450));
RTL  4.12783
LNK  NQRA_CHLMU/2-460:Q9PLU3:AE002269
LNK  NQRA_CHLPN/2-459:Q9Z7G2:AE001656
LNK  NQRA_HAEIN/1-447:P43955:U32702
LNK  NQRA_NEIMA/1-447:Q9JVP8:AL162754
LNK  NQRA_PASMU/1-446:Q9CLB1:AE006171
LNK  NQRA_PSEAE/1-445:Q9HZK6:AE004724
LNK  NQRA_VIBAL/1-446:Q56586:Z37111
LNK  NQRA_YERPE/1-447:Q8ZBZ0:AJ414156
LNK  Q44130_ACTPL/1-449:Q44130:U24492
LNK  Q9X6S0_PORGI/4-450:Q9X6S0:AF144076
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NQRA_NEIMA/1-447
ASQ  MIKIKKGLNLPIAGRPEQVI-YDGPVITE-VALLGEEYAGMRPSMKVKEGDAVKKGQVLFEDKKNPGVVFTAPVSGKIAAIHRGEKRVLQSVVIAVEGNDEIEFERYAPEALANLSGEEVRRNLIQSGLWTALRTRPFSKIPAVDAEPFAIFVNAMDTNPLAADPVVVIKEAAE------DFRRGLLVLSRLTERK..IHVCKAAGADVPSEN.AANI-ETHEFGGPHPAGLSGTHIHFIEPVGANK-TVWTINYQDVIAIGRLFATGRLNTERVIALGGSQV--NKPRLLRTVLGAKVSQITAGELV--DADNRVISGSVLNGAITQGAH-DYLGRYHNQISVIEEGRS-KELFGWVAPQPDKYSITRTTLGHFL.KNK--LFKFTTAVNGGDRAMVPIGTYERVMPLDILPTLLLRDLIVGDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG
DSQ  ATGATTAAAATCAAAAAAGGTCTAAACCTGCCCATCGCGGGCAGACCGGAGCAAGTCATT---TATGACGGGCCCGTCATTACCGAA---GTCGCGTTGCTTGGCGAAGAATATGCCGGTATGCGCCCCTCGATGAAAGTCAAGGAAGGCGATGCCGTCAAAAAAGGCCAAGTGCTGTTTGAAGACAAAAAGAATCCGGGCGTGGTGTTTACCGCGCCGGTTTCAGGCAAAATCGCCGCCATCCATCGCGGCGAAAAGCGCGTACTTCAGTCGGTCGTGATTGCCGTTGAAGGCAACGACGAAATCGAGTTCGAACGCTACGCGCCCGAAGCGTTGGCAAACTTAAGCGGCGAAGAAGTGCGCCGCAATCTGATCCAATCCGGTTTGTGGACTGCGCTGCGTACCCGTCCGTTCAGCAAAATCCCTGCCGTCGATGCCGAGCCGTTCGCCATCTTCGTCAATGCGATGGACACCAATCCGCTGGCGGCAGACCCTGTGGTTGTGATCAAAGAAGCCGCCGAG------------------GATTTCAGACGAGGTTTGCTGGTATTGAGCCGTTTGACCGAGCGTAAA......ATCCATGTGTGTAAGGCAGCTGGCGCAGACGTGCCGTCTGAAAAT...GCTGCCAACATC---GAAACACATGAATTCGGCGGCCCGCATCCGGCCGGTTTGAGTGGCACGCACATTCATTTCATTGAGCCGGTCGGTGCAAACAAA---ACCGTTTGGACCATCAATTATCAAGATGTAATTGCCATCGGACGTTTGTTTGCAACAGGCCGTCTGAACACCGAGCGCGTGATTGCTTTGGGTGGTTCTCAAGTC------AACAAACCACGCCTCTTGCGTACCGTTTTGGGTGCGAAAGTATCGCAAATTACTGCGGGCGAATTGGTT------GACGCAGACAACCGCGTGATTTCCGGTTCGGTATTGAACGGCGCGATTACACAAGGCGCGCAC---GATTATTTGGGACGCTACCACAATCAGATTTCCGTTATCGAAGAAGGCCGCAGC---AAAGAGCTGTTCGGCTGGGTTGCGCCGCAGCCGGACAAATACTCCATCACGCGTACGACCCTCGGCCATTTCCTG...AAAAACAAA------CTCTTCAAGTTCACGACAGCCGTCAACGGTGGCGACCGCGCCATGGTGCCGATTGGTACTTACGAGCGCGTAATGCCGCTAGACATCCTGCCTACCCTGCTTTTGCGCGATTTAATCGTCGGCGATACCGACAGCGCGCAAGCATTGGGTTGCTTGGAATTGGACGAAGAAGACCTCGCTTTGTGCAGCTTCGTCTGCCCGGGCAAATACGAATACGGCCCGCTGTTGCGTAAGGTGCTGGAAACCATTGAGAAGGAAGGC
TRN  10010101100011000
NAM  Q44130_ACTPL/1-449
ASQ  MITIKKGLDLPIAGTPAQVI-HNGNTVNE-VAMLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVVIKVEGDEQITFTRYEAAQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIPSSIFVNAMDTNPLAADPEVVLKEYET------DFKDGLTVLTRLFNGQkpVYLCKDADSNIPLSPaIEGI-TIKSFSGVHPAGLVGTHIHFVDPVGATK-QVWHLNYQDVIAIGKLFTTGELFTDRIISLAGPQV--KNPRLVRTRLGANLSQLTANELN--AGENRVISGSVLSGATAAGPV-DYLGRYALQVSVLAEGRE-KELFGWIMPGSDKFSITRTVLGHFG.K-K--LFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG
DSQ  ATGATTACAATCAAGAAAGGCTTGGATTTACCTATCGCAGGTACACCGGCACAAGTAATC---CATAACGGCAATACCGTTAATGAA---GTTGCGATGCTTGGCGAAGAATATGTGGGTATGCGTCCTTCAATGAAAGTTCGTGAAGGCGATGTAGTGAAAAAAGGTCAGGTTCTTTTTGAAGATAAAAAGAATCCGGGCGTTGTATTTACTGCTCCTGCAAGCGGTACCGTGGTTACTATTAACCGCGGTGAAAAGCGTGTTCTTCAGTCGGTCGTGATTAAAGTTGAGGGTGATGAGCAAATTACCTTTACTCGCTATGAAGCTGCGCAATTAGCGTCGCTATCAGCCGAGCAAGTGAAACAAAATCTTATCGAATCGGGTTTATGGACTGCATTCCGTACTCGTCCGTTCAGTAAGGTTCCCGCATTGGACGCGATTCCGTCATCAATCTTTGTCAATGCAATGGATACCAATCCGTTAGCGGCGGATCCGGAAGTGGTTTTAAAAGAGTACGAAACC------------------GATTTTAAAGACGGTTTAACTGTTTTAACCCGTTTATTTAACGGTCAAaaaccgGTTTACTTATGTAAAGACGCGGACAGCAATATCCCGTTAAGTCCGgcgATTGAAGGTATC---ACAATTAAGTCGTTTAGCGGTGTTCATCCTGCCGGTTTAGTCGGTACGCATATCCACTTTGTTGATCCCGTAGGGGCGACCAAA---CAAGTTTGGCACTTAAATTATCAAGATGTGATTGCTATCGGTAAATTATTTACTACAGGCGAACTCTTTACCGACCGTATTATTTCGCTTGCCGGTCCGCAAGTG------AAAAATCCTCGTTTAGTACGTACGCGTCTTGGTGCGAATCTTTCCCAATTAACCGCAAATGAGTTAAAT------GCCGGTGAAAACCGTGTGATTTCAGGTTCGGTATTGAGCGGTGCGACTGCGGCGGGTCCGGTT---GATTACTTAGGCCGTTACGCATTACAAGTATCCGTACTGGCGGAAGGTCGTGAG---AAAGAGTTATTCGGTTGGATTATGCCGGGTTCGGATAAATTCTCCATTACCCGTACCGTGTTAGGCCACTTCGGT...AAA---AAA------TTATTTAACTTCACTACGGCAGTTCACGGCGGTGAACGTGCAATGGTGCCAATCGGTGCGTATGAGCGTGTAATGCCGTTAGATATTATTCCTACGTTATTACTTCGTGATTTAGCTGCCGGCGATACCGATTCTGCACAAAACTTAGGTTGTTTAGAGCTGGATGAAGAAGATTTGGCATTATGTACTTATGTTTGCCCGGGTAAAAATAACTACGGTCCGATGTTACGTGCTGCGTTAGAGAAGATCGAGAAGGAAGGT
TRN  11011101101011000
NAM  NQRA_PASMU/1-446
ASQ  MITIKKGLNLPISGSPEQVI-RDGNAITE-VALLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVTAIHRGAKRVLQSVVIKIEGNEQITFEKYTTEQLNQLTSEQVRQNLQASGLWTALRTRPFSKVPAVDATPVSIFVNAMDTNPLCADPQVIVQQSAQ------AFEAGLTVLSRLHEGK..VYLCKAANASIPSPS.IANL-DVKEFAGPHPAGLSGTHIHFIDPVSATK-FVWYINYQDVIAVGKLFTTGELDVSRVVSLAGPQV--KNPRLVRTVLGANLSQLTANEVK--DGENRVISGSVLSGAKAAGPV-DYLGRYALQVSVLEEGRE-KEFLGWIMPGANKYSLSRTVLGHFS.K-K--LFNFTTALNGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQALGCLELDEEDLALCTFVCPGKNEYGPLLRQALDKIEKEG
DSQ  ATGATTACGATTAAAAAAGGCTTGAATCTTCCTATTTCGGGAAGCCCAGAGCAGGTAATC---CGTGATGGCAATGCTATCACTGAA---GTTGCTTTGCTTGGTGAAGAGTATGTGGGAATGCGCCCTTCAATGAAGGTGCGTGAAGGTGATGTTGTGAAAAAAGGCCAAGTGCTTTTTGAAGATAAAAAGAACCCTGGTGTGGTTTTCACAGCCCCTGCAAGTGGTACTGTAACTGCGATTCATCGTGGTGCTAAGCGAGTTTTACAATCTGTAGTAATTAAAATTGAAGGTAATGAACAAATTACTTTTGAAAAATATACAACAGAACAATTAAACCAACTTACTTCAGAGCAAGTTCGTCAAAATTTACAAGCTTCTGGATTATGGACCGCACTTCGTACGCGTCCGTTCAGTAAAGTGCCTGCCGTCGATGCCACACCCGTATCGATTTTCGTGAATGCGATGGATACCAATCCATTATGTGCCGATCCACAAGTGATCGTGCAACAATCTGCGCAA------------------GCTTTTGAAGCGGGTCTGACTGTATTAAGTCGTTTACATGAGGGGAAA......GTGTACCTGTGTAAAGCGGCGAATGCGAGCATTCCAAGCCCAAGC...ATTGCCAATCTT---GACGTGAAAGAATTTGCAGGTCCACATCCAGCTGGGTTAAGTGGTACGCATATTCACTTTATTGATCCTGTGAGTGCAACCAAA---TTTGTTTGGTATATCAATTACCAAGATGTGATAGCGGTGGGTAAATTATTTACCACAGGTGAATTAGATGTTTCACGCGTAGTGTCCTTAGCTGGTCCACAAGTG------AAAAATCCAAGATTAGTACGTACCGTATTAGGTGCAAACCTTTCCCAATTAACAGCGAATGAAGTGAAA------GACGGTGAAAATCGCGTGATTTCAGGTTCAGTATTAAGTGGTGCAAAAGCTGCAGGTCCTGTT---GATTATTTAGGTCGTTACGCATTGCAAGTTTCAGTACTTGAAGAAGGTCGTGAG---AAAGAATTTCTAGGTTGGATCATGCCGGGTGCGAATAAATACTCACTTTCACGCACGGTGTTAGGGCATTTCTCT...AAA---AAA------TTATTTAATTTTACCACCGCACTTAATGGCGGTGAGCGTGCGATGGTACCTATCGGTGCTTATGAGCGTGTGATGCCATTGGATATTATTCCAACATTATTACTGCGTGATTTGGCAGCAGGCGATACCGATTCTGCACAGGCGTTAGGGTGTTTAGAGCTAGATGAAGAAGATTTAGCCCTTTGTACCTTTGTTTGCCCTGGTAAAAATGAATATGGTCCGCTCTTACGTCAAGCTTTAGATAAGATCGAGAAGGAAGGT
TRN  10010101100011000
NAM  NQRA_HAEIN/1-447
ASQ  MITIKKGLDLPIAGKPAQVI-HSGNAVNQ-VAILGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVIFTAPASGTITAINRGEKRVLQSVVINVEGDEKITFAKYSTEQLNTLSSEQVKQNLIESGLWTALRTRPFSKVPSIESEASSIFVNAMDTNPLAADPSVVLKEYSQ------DFTNGLTVLSRLFPSK.pLHLCKAGDSNIPTAD.LENL-QIHDFTGVHPAGLVGTHIHFIDPVGIQK-TVWHINYQDVIAVGKLFTTGELYSERVISLAGPQV--KEPRLVRTTIGANLSQLTQNELS--AGKNRVISGSVLCGQIAKDSH-DYLGRYALQVSVIAEGNE-KEFFGWIMPQANKYSVTRTVLGHFS.K-K--LFNFTTSENGGERAMVPIGSYERVMPLDILPTLLLRDLIVGDTDGAQELGCLELDEEDLALCSFVCPGKYEYGSILRQVLDKIEKEG
DSQ  ATGATTACAATTAAGAAAGGTTTGGATCTCCCAATTGCGGGAAAACCAGCACAAGTAATC---CATAGCGGCAACGCTGTGAATCAA---GTTGCGATTCTAGGTGAGGAGTATGTGGGGATGCGTCCTTCAATGAAGGTGCGCGAAGGCGATGTTGTGAAAAAAGGTCAAGTACTTTTTGAAGACAAAAAAAATCCTGGTGTAATTTTTACAGCCCCTGCAAGCGGTACCATCACTGCAATCAATCGTGGCGAAAAACGTGTATTACAATCTGTTGTTATTAATGTAGAAGGTGATGAAAAAATCACTTTTGCAAAATATAGCACAGAACAATTGAATACACTTTCTTCTGAACAAGTAAAACAAAACTTGATAGAATCTGGCTTATGGACGGCATTACGTACTCGTCCATTTAGTAAAGTTCCATCCATTGAAAGTGAAGCATCTTCTATTTTTGTAAATGCGATGGATACCAATCCATTAGCAGCCGATCCCTCTGTCGTATTAAAAGAATATTCGCAA------------------GACTTCACTAACGGTTTAACCGTATTAAGTCGTCTATTCCCTTCAAAA...ccaTTACACTTATGTAAAGCAGGCGATTCTAATATTCCAACTGCTGAT...CTTGAAAATTTA---CAGATTCATGATTTTACTGGTGTTCATCCAGCTGGTCTTGTAGGGACGCATATTCACTTTATTGATCCTGTCGGTATTCAAAAA---ACTGTATGGCATATCAATTATCAAGATGTGATCGCTGTAGGTAAATTATTTACAACAGGCGAACTTTATTCAGAACGAGTAATTTCTCTTGCAGGTCCTCAAGTG------AAAGAACCTCGTTTAGTACGTACAACAATCGGTGCTAATCTTTCTCAATTAACCCAAAATGAATTAAGT------GCAGGTAAAAATCGTGTAATTTCTGGCTCAGTTCTTTGTGGTCAAATAGCAAAAGATTCACAT---GATTATTTAGGTCGCTATGCTTTGCAAGTATCAGTAATCGCTGAAGGTAATGAA---AAAGAATTTTTTGGTTGGATTATGCCACAAGCCAATAAATATTCTGTGACTCGTACCGTATTAGGCCACTTCAGT...AAA---AAA------TTGTTTAATTTTACTACTTCAGAAAATGGTGGCGAACGTGCAATGGTGCCAATCGGTAGCTATGAGCGCGTAATGCCATTGGACATTTTACCTACATTATTATTACGTGATTTAATCGTGGGCGATACCGATGGTGCTCAAGAGTTAGGTTGTCTGGAATTAGACGAAGAAGACTTGGCGTTATGTTCTTTCGTTTGTCCAGGCAAATATGAATACGGTTCAATCTTGCGTCAAGTCTTAGATAAGATTGAGAAGGAAGGT
TRN  10010101100011000
NAM  NQRA_YERPE/1-447
ASQ  MIKIKKGLDLPIAGAPVQTI-QDGPAIHH-VALLGEEYVGMRPSMLVQEGDQVKKGQALFEDKKNPGVLFTAPASGKISAINRGERRVLQSVVIEVEGDEQIPFEHYAAEELNQLSDEQVQHHLLTSGLWTALRTRPFSKTPVPGSRPRAIFISAMDTQPLAADPQVIIATESE------AFNHGLTVLTRLTDGK..VHVCHAAGQAVTRHT.NTQV-TYNEFSGPHPAGLVGTHIHFLEPVSQTK-MVWHVGYQDVIAIGKLFTRGELCTDRIVALAGPQV--NQPILLRTRLGASLSELTAGKLK--EGDNRIISGSVLSGTAFSATH-GYLGRFHQQVSVIREGRE-KELFGWVMPGRDKYSITRTTLGHFF.KRK--LFAFSTDMHGGERAMVPIGNYERVMPLDILATHLLRDLLAGDTDSAQALGCLELDEEDLALCTFVCPGKYEYGPVLRDILTQIEQEG
DSQ  ATGATTAAAATAAAGAAAGGGCTAGATCTTCCCATTGCTGGAGCCCCCGTTCAGACGATA---CAAGATGGTCCAGCGATTCATCAT---GTGGCCCTGCTCGGTGAAGAGTATGTTGGTATGCGTCCTTCAATGTTGGTGCAAGAAGGCGATCAGGTTAAAAAAGGTCAGGCGCTGTTTGAAGACAAAAAGAATCCGGGCGTGTTGTTTACCGCCCCTGCCAGCGGCAAAATCAGTGCTATCAATCGTGGTGAGCGTCGAGTATTGCAATCGGTGGTGATTGAAGTTGAAGGTGATGAGCAAATCCCTTTCGAGCATTATGCTGCTGAGGAGCTTAATCAACTGAGCGATGAGCAGGTTCAACACCATCTGTTGACGTCCGGTTTATGGACTGCGCTGCGGACTCGCCCATTCAGTAAAACACCGGTTCCAGGCAGCCGTCCGCGCGCTATCTTTATCAGTGCGATGGATACCCAACCGTTGGCGGCAGATCCGCAGGTTATTATTGCCACTGAATCAGAG------------------GCGTTTAACCATGGCTTGACCGTATTGACGCGGCTGACGGACGGTAAA......GTACACGTCTGCCACGCGGCAGGGCAGGCTGTGACTCGTCATACC...AATACGCAAGTG---ACTTACAACGAATTCTCCGGGCCGCACCCTGCGGGTCTGGTGGGGACACATATTCATTTTCTTGAGCCAGTCAGCCAGACCAAA---ATGGTTTGGCATGTGGGCTATCAGGATGTCATTGCTATCGGTAAATTGTTTACCCGTGGTGAGTTGTGTACTGACCGCATCGTCGCTTTGGCGGGTCCACAGGTG------AATCAACCCATTTTATTGCGTACTCGTTTAGGGGCCAGCTTATCTGAACTGACCGCCGGTAAACTAAAA------GAGGGTGATAACCGCATTATTTCAGGTTCAGTCCTCAGCGGTACCGCGTTCTCTGCTACCCAT---GGGTATCTGGGGCGTTTTCATCAGCAAGTCTCCGTTATCCGCGAAGGGCGTGAA---AAAGAGTTATTTGGTTGGGTGATGCCGGGGCGCGATAAATACTCCATTACCCGCACGACGCTGGGCCACTTCTTC...AAACGCAAA------TTGTTTGCTTTCTCGACTGATATGCACGGTGGTGAGCGTGCCATGGTGCCAATTGGCAACTATGAGCGGGTCATGCCACTGGATATCCTGGCGACCCATCTGCTACGTGATTTATTGGCCGGTGATACCGACAGCGCACAAGCACTCGGTTGTTTGGAGTTGGACGAAGAAGATCTGGCTTTGTGTACTTTTGTTTGTCCCGGTAAGTACGAATACGGTCCGGTACTGCGCGACATACTGACCCAGATTGAGCAGGAAGGA
TRN  10010101100011000
NAM  NQRA_VIBAL/1-446
ASQ  MITIKKGLDLPIAGTPSQVI-NDGKTIKK-VALLGEEYVGMRPTMHVRVGDEVKKAQVLFEDKKNPGVKFTAPAAGKVIEVNRGAKRVLQSVVIEVAGEEQVTFDKFEAAQLSGLDREVIKTQLVDSGLWTALRTRPFSKVPAIESSTKAIFVTAMDTNPLAAKPELIINEQQE------AFIAGLDILSALTEGK..VYVCKS-GTSLPRSS.QSNV-EEHVFDGPHPAGLAGTHMHFLYPVNAEN-VAWSINYQDVIAFGKLFLTGELYTDRVVSLAGPVV--NNPRLVRTVIGASLDDLTDNELM--PGEVRVISGSVLTGTHATGPH-AYLGRYHQQVSVLREGRE-KELFGWAMPGKNKFSVTRSFLGHVF.KGQ--LFNMTTTTNGSDRSMVPIGNYERVMPLDMEPTLLLRDLCAGDTDSAQALGALELDEEDLALCTFVCPGKYEYGTLLRECLDTIEKEG
DSQ  ATGATTACAATAAAGAAGGGCTTGGATCTTCCTATCGCAGGAACTCCATCCCAGGTGATT---AATGATGGTAAGACCATCAAAAAA---GTCGCCTTGCTTGGCGAAGAGTACGTTGGCATGCGTCCTACCATGCATGTCCGCGTTGGTGATGAAGTGAAAAAAGCGCAAGTTCTTTTTGAAGATAAAAAGAACCCTGGCGTGAAATTTACTGCACCAGCAGCCGGTAAAGTGATCGAAGTTAACCGTGGCGCTAAACGTGTCCTTCAATCTGTAGTGATTGAAGTGGCAGGTGAAGAGCAGGTGACATTTGATAAGTTCGAAGCCGCTCAACTTTCAGGTCTAGATCGTGAAGTGATCAAGACTCAGTTGGTTGACTCTGGCCTATGGACCGCTTTACGTACTCGTCCGTTTAGCAAGGTTCCTGCAATCGAGTCTTCTACTAAGGCTATTTTCGTAACTGCAATGGATACTAATCCATTAGCAGCTAAGCCTGAGTTGATCATTAATGAGCAACAAGAA------------------GCATTCATTGCTGGTCTAGACATTCTTTCAGCCCTGACAGAAGGCAAG......GTTTACGTATGTAAATCT---GGCACTAGTTTGCCACGCTCTTCA...CAGTCTAACGTA---GAAGAACACGTCTTCGATGGCCCTCACCCAGCAGGTCTTGCTGGCACCCACATGCATTTCCTATACCCAGTGAATGCAGAAAAT---GTGGCATGGAGCATCAACTACCAAGACGTTATCGCGTTCGGTAAGCTGTTCCTAACTGGTGAGCTATACACAGATCGTGTTGTGTCTCTAGCTGGTCCAGTTGTG------AATAACCCTCGTCTAGTTCGTACCGTAATCGGTGCAAGCTTGGATGACCTAACAGATAACGAGTTGATG------CCTGGCGAAGTTCGTGTGATTTCTGGTTCTGTACTGACAGGTACACATGCAACTGGTCCACAC---GCATACCTTGGCCGTTACCATCAACAGGTTTCTGTATTACGTGAAGGCCGTGAG---AAAGAACTATTTGGCTGGGCAATGCCTGGTAAGAATAAGTTCTCGGTAACTCGCTCTTTCCTTGGTCACGTATTC...AAAGGTCAG------TTGTTCAATATGACAACGACGACCAATGGTAGTGATCGTTCAATGGTTCCAATTGGCAACTACGAACGCGTAATGCCTCTAGATATGGAGCCTACTCTGCTGCTTCGTGATCTATGTGCAGGTGATACAGACAGTGCTCAAGCACTGGGTGCGCTTGAACTGGATGAAGAAGATCTAGCATTGTGTACCTTTGTATGTCCAGGTAAGTACGAGTACGGTACGTTACTTCGTGAATGCCTAGATACTATCGAGAAGGAAGGG
TRN  10010101100011000
NAM  NQRA_PSEAE/1-445
ASQ  MIKIKRGLDLPISGAPEQRI-EAARPVRS-VALIGFDYHGMKPTMAVQVGDRVKLGQVLFTDKKNPSVSYTAPGAGVVSAIHRGEKRVLQSVVIDLDGDEQLEFARYPADKLATLSAEQVRDNLLQSGLWTALRTRPFSKVPDPESSPSSIFVTAIDTQPLAADPQVVIAEQGE------AFQAGLTVLGRLA--R..VFLCKAEGVSLPGEA.LSGV-TAQAFSGPHPAGLPGTHIHFLDPVGAGK-SVWNLNYQDVIAIGKLFTTGQLWTERVIALAGPVV--EKPRLVRTRLGANLDELAAGQLQ--PGNNRLISGSVLGGRTAHGAY-AYLGRYHLQLSCLKEGDQ-REFLHYLRAGVEKHSLLNVFVSRLL.GGK--RFAFTTSTNGSPRAMVPVGNYEAVMPLDILPTQLLRYLIVGDTEMAQKLGALELDEEDLALCSYVCAGKYEYGPILRDNLARIEQEG
DSQ  ATGATCAAGATAAAACGTGGCCTGGACCTGCCCATCAGCGGCGCCCCCGAACAGCGCATC---GAGGCAGCACGCCCGGTACGCAGC---GTGGCGTTGATCGGTTTCGACTACCACGGCATGAAGCCGACCATGGCGGTGCAGGTAGGCGACCGGGTGAAGCTGGGGCAGGTGCTGTTCACCGACAAGAAGAATCCCTCCGTCAGCTATACCGCACCCGGCGCCGGTGTGGTCAGTGCCATCCATCGTGGCGAGAAGCGCGTCCTGCAATCGGTGGTCATCGATCTCGACGGCGACGAGCAACTGGAGTTCGCCCGTTATCCCGCTGACAAACTCGCCACGCTGAGCGCCGAGCAGGTCCGCGACAACCTGTTGCAGTCGGGCCTGTGGACCGCGCTGCGGACCCGGCCGTTCAGCAAGGTGCCCGATCCCGAGTCCAGCCCCAGTTCGATTTTCGTCACTGCCATCGATACCCAGCCGCTGGCCGCCGATCCGCAGGTGGTTATCGCGGAGCAGGGCGAG------------------GCCTTCCAGGCCGGGCTGACGGTGCTCGGGCGCCTGGCC------CGG......GTGTTCCTGTGCAAGGCGGAAGGCGTTTCGCTACCCGGCGAGGCG...CTCTCCGGCGTG---ACCGCGCAAGCATTCTCCGGTCCGCATCCGGCGGGCCTGCCCGGCACCCATATCCACTTCCTTGACCCGGTGGGTGCCGGCAAG---AGCGTGTGGAACCTGAACTACCAGGACGTGATCGCCATCGGCAAGCTGTTCACGACCGGGCAATTGTGGACCGAGCGGGTGATCGCCCTGGCCGGTCCGGTGGTG------GAAAAGCCGCGTCTGGTGCGCACCCGCTTGGGCGCCAACCTCGACGAACTGGCCGCCGGCCAGTTGCAG------CCGGGCAACAACCGGCTGATCTCCGGCTCCGTGCTGGGCGGTCGCACCGCCCATGGCGCCTAC---GCCTACCTGGGGCGCTACCACCTGCAGTTGTCCTGTCTCAAGGAGGGCGACCAG---CGCGAGTTCCTCCACTACCTGCGCGCCGGGGTGGAAAAGCATTCGCTGCTCAACGTGTTCGTCTCCAGGCTGCTC...GGCGGCAAG------CGCTTCGCCTTCACCACCAGCACCAACGGCAGCCCACGGGCGATGGTGCCGGTAGGTAACTACGAGGCGGTGATGCCGCTGGATATCCTGCCGACTCAATTGCTGCGCTACCTGATCGTCGGCGACACGGAAATGGCCCAGAAGCTCGGCGCCCTGGAACTCGACGAAGAGGACCTGGCGCTGTGCAGCTACGTCTGCGCCGGCAAGTACGAATACGGCCCGATTCTGCGGGACAATCTGGCACGCATCGAGCAGGAGGGC
TRN  10010101100011011
NAM  Q9X6S0_PORGI/4-450
ASQ  VIKTKKGLALNLKGKPLPEMLAEPAQSPT-YAVVPDDFEGVIPKVTARPGDKVRAGSALMHHKAYPEMKFTSPVSGEVIAVNRGAKRKVLSIEVKPDGLNE--YESFPVGDPSALSAEQIKELLLSSGMWGFIKQRPYDIVATPDIAPRDIYITANFTAPLAPDFDFIVRGEER------ALQTAIDALAKLTTGK..VYVGLKPGSSLGLHN.----AEIVEVHGPHPAGNVGVLINHTKPINRGE-TVWTLKATDLIVIGRFLLTGKADFTRMIAMTGSDA--AAHGYVRIMPGCNVFASFPGRLTIKESHERVIDGNVLTGKKLCEKE-PFLSARCDQITVIPEGDDVDELFGWAAPRLDQYSMSRAYFSWLQgKNK--EYVLDARIKGGERAMIMSNEYDRVFPMDIYPEYLLKAIIAFDIDKMEDLGIYEVAPEDFATCEFVDTSKIELQRIVREGLDMLYKEM
DSQ  GTTATAAAAACAAAAAAAGGCCTTGCACTTAATCTGAAAGGAAAACCGCTGCCCGAGATGCTGGCCGAACCGGCCCAAAGTCCTACT---TACGCGGTCGTGCCCGACGATTTTGAAGGTGTTATCCCCAAGGTGACGGCTCGTCCGGGGGATAAGGTGCGTGCCGGCTCAGCACTGATGCACCACAAGGCATATCCGGAGATGAAGTTTACAAGTCCGGTTAGCGGCGAAGTGATCGCGGTGAATCGCGGTGCCAAGCGCAAGGTGTTGAGCATCGAGGTGAAACCGGACGGACTGAACGAA------TACGAGTCATTCCCTGTCGGGGATCCGTCTGCCCTCTCTGCCGAACAGATCAAGGAGCTTTTACTGTCGAGCGGTATGTGGGGTTTTATTAAGCAACGTCCTTACGACATAGTGGCTACACCGGATATAGCTCCACGCGACATTTATATTACTGCCAACTTTACTGCACCATTGGCTCCGGACTTCGATTTCATCGTTCGAGGAGAAGAACGC------------------GCCCTGCAGACTGCCATCGATGCCTTGGCCAAACTCACGACAGGAAAG......GTGTATGTGGGCCTGAAGCCGGGTTCATCTCTGGGCTTGCACAAT...------------GCAGAAATCGTAGAAGTACACGGACCTCATCCGGCAGGTAACGTGGGCGTGCTGATCAATCATACGAAGCCAATCAATCGGGGCGAA---ACGGTGTGGACGCTCAAGGCTACCGACCTGATCGTGATCGGACGTTTCCTGCTTACGGGCAAAGCCGATTTTACCAGAATGATTGCCATGACCGGCTCAGACGCT------GCAGCTCACGGATACGTCCGTATTATGCCGGGTTGCAATGTCTTTGCTTCCTTCCCCGGCCGACTGACAATAAAGGAATCTCACGAGCGTGTGATCGATGGCAATGTGCTGACCGGTAAGAAGCTCTGCGAGAAGGAG---CCTTTCCTGTCAGCCCGGTGTGACCAGATCACGGTGATCCCCGAAGGCGACGATGTGGACGAACTCTTCGGGTGGGCTGCACCCCGTCTCGATCAGTACAGCATGAGCAGAGCTTATTTCTCTTGGTTGCAGgggAAAAACAAA------GAGTACGTACTCGATGCCCGGATCAAGGGTGGCGAACGTGCTATGATCATGAGCAACGAGTATGACCGCGTTTTCCCGATGGACATCTATCCGGAGTATTTGCTCAAGGCTATTATAGCATTCGACATCGACAAGATGGAGGACTTAGGCATATATGAAGTGGCTCCGGAGGACTTTGCCACTTGCGAATTTGTGGATACATCCAAGATCGAGCTGCAGCGTATCGTTCGCGAGGGCTTGGATATGCTCTATAAGGAAATG
TRN  10010101100011000
NAM  NQRA_CHLMU/2-460
ASQ  KIIVSRGLDLSLKGAPKESG-FCGKVDPAFVSVDLRPFAPLPLGVKVSPGDQITAGSPLAEYKSFPGVFITSSVDGEVIEIRRGSKRALLDIVIKKKPGVSQTKFSY---DLHALSQKELLEVFKKEGLFTLFKQRPFNIPALPTQSPRDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFGLK..PHIVSTDRLSLPTQD.LISVAHLHTIAGPYPSGSPSTHIHHIARIRNDRDIVFTISFQEVLSIGHLFLKGFFLGQQVVALAGSALPPSQRKYLITAKGASFKDLLPQEIF-SSNDVSLISGDPLTGRLCNKEENPCLGMRDHTITILPNPKT-REMFSFLRLGWNKLTVTRTYLSGFF.KRKRVFMDMNTNLHGEKRPIIDSEIYEKVSAIAVPVAPLIKALETQNFEEACRLGLLEVSPEDFALPTFIDPSKTEMFAIVKEALIRYAKEN
DSQ  AAGATAATAGTTTCTCGTGGATTAGATCTGTCTTTAAAAGGAGCCCCTAAGGAATCGGGT---TTTTGCGGAAAAGTGGATCCCGCTTTTGTTTCCGTGGATCTGAGACCTTTTGCTCCCCTACCACTTGGTGTGAAAGTTTCTCCAGGAGACCAGATTACAGCTGGTTCTCCCTTAGCGGAATATAAGTCTTTCCCAGGTGTTTTCATCACCTCGTCGGTTGATGGAGAGGTTATCGAAATCCGTAGAGGAAGTAAGCGGGCTCTTTTGGATATCGTGATTAAAAAAAAGCCTGGGGTTTCTCAAACGAAGTTCTCTTAT---------GACCTCCACGCTTTATCTCAAAAGGAGCTTTTAGAAGTCTTTAAAAAAGAAGGGCTTTTTACCCTTTTTAAACAAAGACCTTTCAATATCCCAGCGCTCCCAACACAATCCCCTAGAGATGTTTTTATTAACTTAGCGGACAATCGTCCATTCACCCCATCTGTAGAAAAACATCTAAGTCTTTTCTCTTCAAAAGAAGATGGTTATTACATTTTTGTTGTGGGAGTTCAGGCTATAGCAAAACTATTTGGTCTCAAA......CCACATATTGTTTCCACAGATAGGCTCTCTTTACCTACCCAAGAT...TTAATATCTGTAGCTCATTTACATACAATAGCTGGTCCTTACCCTTCGGGATCTCCTTCGACCCATATTCATCATATCGCACGAATTCGCAATGACAGGGATATCGTATTCACAATTAGCTTCCAAGAAGTCCTCTCTATCGGCCATCTATTCTTAAAGGGATTTTTCCTAGGACAACAAGTCGTTGCATTAGCAGGATCTGCTCTCCCGCCTTCTCAAAGGAAATATCTGATCACAGCAAAAGGAGCCAGCTTCAAAGACTTGTTACCACAAGAAATCTTC---TCTTCCAACGATGTCAGTTTAATTTCGGGGGATCCTCTTACAGGAAGATTGTGTAACAAAGAAGAAAATCCTTGTTTAGGCATGCGGGACCATACCATAACGATTCTTCCAAACCCTAAAACC---CGAGAGATGTTTAGTTTCTTACGATTAGGATGGAATAAACTTACGGTCACCAGAACCTATCTCTCTGGATTCTTC...AAGAGAAAACGCGTGTTCATGGATATGAATACCAATTTACACGGGGAAAAACGCCCAATCATTGATTCTGAAATCTATGAGAAAGTTTCGGCAATTGCAGTTCCTGTAGCCCCTCTTATTAAAGCTTTAGAAACTCAAAATTTTGAAGAAGCGTGTCGCTTGGGACTCTTAGAAGTCTCCCCAGAAGATTTTGCTCTACCAACATTTATAGATCCTTCTAAAACAGAGATGTTTGCTATTGTAAAAGAAGCTCTCATCCGTTACGCGAAAGAAAAT
TRN  10010101100011000
NAM  NQRA_CHLPN/2-459
ASQ  KITVNRGLDLSLQGSPKESG-FYNKIDPEFVSIDLRPFQPLSLKLKVEQGDAVCSGAPIAEYKHFPNTYITSHVSGVVTAIRRGNKRSLLDVIIKKTPGPTSTEYTY---DLQTLSRSDLSEIFKENGLFALIKQRPFDIPAIPTQTPRDVFINLADNRPFTPSPEKHLALFSSREEGFYVFVVGVRAIAKLFGLR..PHIVFRDRLTLPTQE.LKTIAHLHTVSGPFPSGSPSIHIHSVAPITNEKEVVFTLSFQDVLTIGHLFLKGRILHEQVTALAGTALKSSLRRYVITTKGASFSSLINLNDI-SD-NDTLISGDPLTGRLCKKEEEPFLGFRDHSISVLHNPTK-RELFSFLRIGFNKPTFTKTYLSGFF.KKKRTYTNPDTNLHGETRPIIDTDIYDKVMPMRIPVVPLIKAVITKNFDLANELGFLEVCGEDFALPTLIDPSKTEMLTIVKESLIEYAKES
DSQ  AAAATTACAGTCAATCGGGGTTTAGATTTATCCTTACAAGGGTCTCCCAAAGAATCTGGT---TTCTATAACAAAATCGATCCAGAATTCGTATCTATAGACTTAAGGCCATTCCAACCTTTATCTCTTAAACTTAAGGTAGAGCAAGGAGATGCGGTCTGTTCAGGAGCTCCTATAGCAGAATACAAGCACTTTCCTAACACCTACATTACCTCTCACGTTTCAGGAGTAGTTACCGCTATACGACGTGGAAATAAACGTTCTCTTTTAGATGTCATCATTAAGAAAACTCCTGGTCCTACATCTACAGAATATACGTAT---------GATCTCCAAACTCTCTCACGTTCAGATCTTTCCGAAATCTTTAAGGAAAATGGGCTCTTTGCATTAATCAAACAACGTCCTTTTGATATTCCCGCAATTCCAACACAAACTCCGAGAGATGTTTTCATCAATTTAGCTGACAATCGTCCTTTTACTCCAAGCCCAGAAAAACATCTGGCTCTCTTTTCCTCTAGAGAAGAAGGATTTTATGTATTTGTGGTAGGAGTTCGAGCTATAGCTAAACTTTTTGGACTCCGT......CCTCATATAGTTTTCAGAGATCGTTTAACTCTACCTACGCAAGAA...CTAAAGACAATTGCTCACCTTCATACCGTTTCGGGACCATTCCCCTCTGGATCTCCATCGATACATATTCACAGCGTAGCCCCTATTACCAATGAGAAAGAAGTGGTATTCACACTGTCATTTCAAGATGTCCTTACTATTGGCCATCTTTTCTTAAAGGGAAGAATTCTGCACGAGCAAGTCACAGCACTTGCTGGTACTGCACTAAAAAGTTCTCTAAGACGCTATGTGATTACTACAAAAGGAGCTAGCTTCTCTAGTTTAATCAATCTTAATGACATC---TCGGAT---AACGATACATTAATTAGCGGAGATCCCTTAACAGGAAGGCTATGCAAAAAGGAAGAGGAACCCTTTTTAGGATTTCGAGACCATTCAATTTCAGTCTTACACAACCCAACAAAA---CGGGAGTTGTTTAGCTTTTTAAGAATTGGGTTTAACAAACCGACATTTACAAAAACCTATCTCTCAGGATTTTTC...AAGAAAAAGCGTACCTATACGAATCCAGATACTAACCTCCACGGAGAAACTCGGCCGATTATTGATACTGACATCTATGATAAAGTTATGCCGATGAGAATTCCTGTAGTTCCTCTGATTAAAGCTGTAATTACTAAAAATTTTGATTTAGCTAATGAACTAGGGTTTTTAGAGGTTTGTGGTGAAGATTTCGCCTTACCCACTCTTATAGATCCATCTAAAACAGAAATGCTTACCATAGTCAAGGAATCCTTAATAGAGTACGCCAAGGAATCA
TRN  10010101100011000
//