EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05868 - Rotavirus_VP7)
FAM  PF05868
PID  Rotavirus_VP7
DES  Rotavirus major outer capsid protein VP7
IPR  IPR008818
ANO  3
ALN  249
AID  0.57434
APH  (P87518_9REOV/1-247:0.31084,VS09_ROTGA/1-249:0.26220,VS09_ROTGI/2-246:0.53550);
ATP  (P87518_9REOV/1-247,VS09_ROTGA/1-249,VS09_ROTGI/2-246);
ATL  1.10854
DNO  3
DLN  747
DID  0.594942
DPH  (P87518_9REOV/1-247:0.28557,VS09_ROTGA/1-249:0.30739,VS09_ROTGI/2-246:0.34563);
DTP  (P87518_9REOV/1-247,VS09_ROTGA/1-249,VS09_ROTGI/2-246);
DTL  0.93859
RID  0.57434
RPH  (P87518_9REOV/1-247:0.31084,VS09_ROTGA/1-249:0.26220,VS09_ROTGI/2-246:0.53550);
RTP  (P87518_9REOV/1-247,VS09_ROTGA/1-249,VS09_ROTGI/2-246);
RTL  1.10854
LNK  P87518_9REOV/1-247:P87518:U84473
LNK  VS09_ROTGA/1-249:P18570:M33872
LNK  VS09_ROTGI/2-246:P30889:D00911
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P87518_9REOV/1-247
ASQ  MPLPLLLVFAACAKAQLVITPISNPEICVLHASDW--NVNSFGDNFTNIFETYNSVTLSFYQYDSTNYEVIDIISKRDYSLCHILAIDVVKPEMDFITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKNLSLSPLSDSLIGLYCDTEINGTYFPLSENEKYDVTDLPEFTEMGYVFYSNDDFYICKRINDHKWVNYHLFYREYSASGTVSRAISWDNVWTGFKTFAQVVYKILDIFFNNRRNFEPRA
DSQ  ATGCCGTTGCCATTGCTTCTCGTATTTGCTGCTTGTGCAAAAGCTCAATTAGTAATTACACCAATAAGCAATCCGGAGATTTGTGTGCTGCACGCTAGTGACTGG------AATGTGAATAGTTTCGGCGATAACTTTACAAATATTTTTGAAACATATAACTCAGTGACTCTATCCTTCTACCAGTATGATAGTACCAACTATGAAGTGATTGATATTATATCTAAGAGAGATTATTCGCTGTGCCATATATTGGCAATAGATGTTGTAAAGCCTGAAATGGATTTCATTACGTTCCTTCAGTCAAATAATGAATGTACAAAGTATGCAGGACAGAAAATACATTATCAAAAACTTTCTACGAACGAAGAATGGTTTGTATATTCAAAGAATTTGTCACTATCTCCACTATCTGACAGCCTGATCGGATTGTATTGCGATACCGAGATAAATGGTACATATTTTCCATTGTCAGAGAATGAAAAATACGATGTTACGGATCTACCAGAGTTTACAGAAATGGGTTACGTTTTCTATTCGAACGATGACTTTTATATTTGTAAGCGTATCAATGACCATAAATGGGTAAACTATCATCTTTTTTACAGAGAATACTCGGCCTCAGGAACGGTGTCAAGAGCTATCAGTTGGGACAATGTATGGACTGGTTTCAAAACGTTCGCGCAGGTTGTATATAAAATACTAGATATTTTTTTCAACAATAGAAGAAACTTTGAGCCACGAGCA
TRN  10010101100011000
NAM  VS09_ROTGA/1-249
ASQ  MASLLLLVLAAAVTAQLNIVPSTHPEVCVLYADDHQADANKFNGNFTQIFHSYNSITLSFMSYSSSSYDVIDIISKYDLSSCNILAIDVFNASMDFNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKNLKFCPLSDSLIGMYCDTQLSDTYFEISTGGTYEVTDIPEFTQMGYTFHSSEEFYLCHRISSEAWLNYHLFYRDYDVSGVISKQVNWGNVWSGFKTFAQVLYKILDLFFNSKRNVEPRA
DSQ  ATGGCTTCATTGCTGCTTCTCGTCCTTGCTGCTGCGGTCACCGCTCAACTCAACATTGTTCCTTCTACACATCCTGAAGTATGTGTGCTCTATGCTGATGACCATCAAGCTGACGCAAATAAATTTAATGGTAATTTCACCCAAATATTCCATTCATATAACTCAATAACGTTGTCATTTATGAGTTATTCTTCTTCATCCTATGACGTAATTGACATAATATCTAAATATGATCTCAGTTCTTGTAACATATTAGCCATTGATGTATTTAACGCTTCAATGGATTTTAATGTTTTCCTTCAGTCCACTAATAATTGTTCAAAATATAACGCTAATAAGGTTCACCATGTTAAATTGCCTCGTGGAGAGGAATGGTTCTCATATTCCAAAAATCTAAAGTTTTGTCCTTTATCTGATTCTTTAATAGGAATGTATTGTGATACTCAACTTTCTGACACATACTTCGAAATATCCACTGGTGGAACATACGAAGTTACAGACATACCTGAATTCACTCAAATGGGATACACATTCCATTCAAGTGAGGAGTTTTATTTGTGTCACAGAATTTCCAGTGAGGCTTGGCTAAATTATCATCTATTTTATCGAGACTATGATGTATCTGGAGTCATAAGTAAACAAGTAAACTGGGGAAACGTATGGTCAGGTTTTAAAACCTTTGCCCAAGTTTTATATAAAATACTAGATTTGTTTTTTAATAGTAAGAGAAACGTTGAACCGCGTGCA
TRN  10010101100011000
NAM  VS09_ROTGI/2-246
ASQ  TTMLLLLVVAALANGQLTILPHEESQICFLQPDNPGFD---FDGNFTNIFRDYASVKISSFTYKAQDADIVEILNVDRDRSCTILAIYIADSTLDFNTFLQSENECVKYAASKKHYIKLPRDREYFALAKNLSFCPLNDDLIGIYCDTQLETTYFSVARSSNYDVTDIPEFTELGYVFHSNDHFYICERKSEGNWIDYQLFYQNDAPLGTVSQRVNWGNVWSNVKTVAQMVYKILDIFFG-KRNIEPRA
DSQ  ACAACTATGTTGTTGCTTCTCGTCGTTGCTGCTCTGGCTAATGGTCAGCTAACTATACTACCACATGAAGAATCACAAATCTGTTTTTTGCAACCAGACAACCCAGGGTTTGAT---------TTTGATGGCAATTTCACAAATATATTTAGGGATTATGCTTCTGTAAAAATATCCAGTTTCACTTATAAAGCTCAGGATGCAGACATCGTCGAAATACTAAATGTAGATAGAGATAGAAGTTGTACTATACTAGCAATCTACATCGCAGACTCGACGCTGGATTTCAATACATTTTTGCAGTCTGAAAATGAATGCGTCAAGTACGCAGCTAGTAAGAAACATTATATTAAATTGCCCCGTGACAGAGAATACTTCGCTTTGGCGAAAAATTTATCATTCTGTCCGTTAAATGATGATTTAATTGGAATATATTGCGATACGCAGCTCGAGACTACGTATTTTTCAGTAGCACGCAGCTCAAACTATGATGTAACGGATATACCAGAATTCACAGAGCTAGGTTATGTCTTTCATTCGAATGATCATTTTTACATATGTGAAAGGAAGAGTGAAGGCAATTGGATAGATTATCAGCTGTTCTACCAAAATGATGCTCCCTTGGGAACGGTATCTCAACGTGTAAATTGGGGAAACGTTTGGTCGAATGTCAAAACTGTTGCACAGATGGTCTACAAAATACTTGATATTTTCTTTGGA---AAGAGGAACATTGAGCCACGCGCA
TRN  10010101100011000
//