EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05851 - Lentivirus_VIF)
FAM  PF05851
PID  Lentivirus_VIF
DES  Lentivirus virion infectivity factor (VIF)
IPR  IPR008668
ANO  4
ALN  252
AID  0.518964
APH  ((Q84810_9RETR/31-272:0.83588,P89687_9RETR/2-252:0.32955):0.24355,Q66934_9RETR/1-251:0.12102,VIF_FIVSD/1-251:0.14003);
ATP  ((Q84810_9RETR/31-272,P89687_9RETR/2-252),Q66934_9RETR/1-251,VIF_FIVSD/1-251);
ATL  1.67003
DNO  4
DLN  756
DID  0.591867
DPH  ((Q84810_9RETR/31-272:0.54120,P89687_9RETR/2-252:0.27971):0.18766,Q66934_9RETR/1-251:0.15124,VIF_FIVSD/1-251:0.11840);
DTP  ((Q84810_9RETR/31-272,P89687_9RETR/2-252),Q66934_9RETR/1-251,VIF_FIVSD/1-251);
DTL  1.27821
RID  0.518964
RPH  ((Q84810_9RETR/31-272:0.83588,P89687_9RETR/2-252:0.32955):0.24355,Q66934_9RETR/1-251:0.12102,VIF_FIVSD/1-251:0.14003);
RTP  ((Q84810_9RETR/31-272,P89687_9RETR/2-252),Q66934_9RETR/1-251,VIF_FIVSD/1-251);
RTL  1.67003
LNK  P89687_9RETR/2-252:P89687:U56928
LNK  Q66934_9RETR/1-251:Q66934:U11820
LNK  Q84810_9RETR/31-272:Q84810:U03982
LNK  VIF_FIVSD/1-251:P19029:M36968
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P89687_9RETR/2-252
ASQ  SGEEDWQVSRSLYQVLLGGPRRAMLYIGSIIDEKEKARKKKDLQKRMARLENRFIYWLRRQEGIRWSFHTRDYHLGFVKELVAGSSSPGCLRLYCYISNPLWHKRYRPTL-QMNQEFPYVNCWITDKFMWDDIENQQIMKSPLPGPGWDIGMVGLVIKAYSCPEKKYDVTIPQVIRGEKDPQEFCADCWNLICVRNSPPCSLQRLALKACGKPTESWVGCCNHRFLSPYRSPTDLLIVREAVPYEVLYRMKS
DSQ  AGTGGTGAAGAGGATTGGCAGGTAAGTAGATCTCTCTATCAAGTGCTTCTAGGGGGACCTAGAAGAGCTATGCTCTATATAGGAAGTATAATAGATGAAAAGGAAAAGGCTAGAAAGAAAAAAGACCTACAAAAAAGAATGGCTAGACTAGAAAATAGATTTATCTATTGGTTAAGGAGACAAGAAGGGATCAGATGGTCTTTTCATACAAGAGATTATCATCTAGGATTTGTAAAAGAGTTAGTTGCAGGAAGCTCTAGTCCTGGATGTTTAAGATTATATTGTTACATTAGTAATCCATTGTGGCATAAAAGGTATAGGCCTACTTTG---CAGATGAATCAAGAATTTCCATATGTAAATTGTTGGATTACGGATAAATTTATGTGGGATGATATAGAGAACCAGCAAATAATGAAGAGTCCTTTACCTGGTCCAGGATGGGATATAGGAATGGTGGGATTAGTAATAAAAGCATATTCCTGCCCAGAAAAGAAGTATGATGTGACAATACCACAGGTAATACGGGGAGAAAAAGATCCTCAAGAATTTTGTGCTGATTGTTGGAATCTAATATGTGTAAGGAATTCACCACCATGTAGTCTGCAAAGATTGGCTTTAAAGGCCTGTGGCAAACCAACAGAAAGTTGGGTAGGATGTTGCAACCACAGATTTTTATCTCCTTACAGATCACCTACTGACTTATTGATAGTCAGAGAAGCTGTACCCTATGAAGTGTTATATCGGATGAAGAGT
TRN  10010101100011000
NAM  Q66934_9RETR/1-251
ASQ  MSDEDWQVSRRLFAVLQGGIHSAMLYISSL-PEMEQNKCKRSFKKRLSDKETGFIFRLRKAEGIRWSFHTRDYYIGYVREMVAGSSLPDSLRLYVYISNPLWHQSYRPGLTNFNTEWPFVNMWIKTGFMWDDIESQNICKGGEISHGWGPGMVGVVIKAFSCGERKIKITPAMIIRGEIDPQKWCGDCWNLMCLKYSPPNTLQRLAMLARGKEAKEWRGCCNQRFVSPFRTPCDLEVVQNKPKRNLLWTGEL
DSQ  ATGAGTGACGAAGATTGGCAGGTAAGTAGAAGACTCTTTGCAGTTCTTCAAGGAGGAATACACAGTGCCATGTTGTACATATCGAGCCTA---CCTGAAATGGAACAAAATAAATGTAAAAGGAGCTTTAAGAAAAGGCTTTCGGATAAGGAAACAGGATTCATATTTAGATTAAGAAAAGCTGAAGGAATAAGGTGGAGCTTCCATACCAGAGATTATTATATAGGATATGTAAGAGAGATGGTGGCTGGATCTAGCCTACCAGATAGTTTAAGATTATATGTTTATATAAGCAATCCATTGTGGCACCAGTCATACCGTCCTGGCCTGACAAATTTTAATACAGAATGGCCTTTTGTAAATATGTGGATAAAGACAGGATTTATGTGGGATGATATTGAAAGCCAGAATATTTGCAAAGGAGGAGAGATCTCACATGGATGGGGACCTGGAATGGTGGGAGTTGTAATAAAAGCATTTAGTTGTGGGGAAAGGAAAATAAAAATTACTCCTGCTATGATTATAAGAGGTGAAATAGACCCACAGAAATGGTGTGGAGATTGTTGGAATCTGATGTGTCTTAAATATTCACCTCCAAATACATTGCAAAGGCTTGCTATGCTGGCGCGTGGCAAAGAGGCTAAAGAATGGAGAGGCTGTTGTAATCAGCGTTTTGTTTCTCCTTTCAGAACACCATGTGATCTAGAGGTCGTCCAGAACAAGCCTAAAAGAAATTTATTGTGGACGGGAGAATTA
TRN  10010101100011000
NAM  VIF_FIVSD/1-251
ASQ  MSDEDWQVSRRLFAVLQGGVYNAMLYISRL-PQDEREKYKKDFKKRLLDTETGFIKRLRKAEGIKWSFHTRDYHVGYVREMVAGPTTPHSLRLYVYISNPLWHSQYRPGLVNFNKEWPFVNLWIKTGFMWDDIEKQNICIGGEVSPGWGPGMIGIAIKAFSCGERKIEATPVMIIRGEINPKKWCGDCWNLMCLRNSPPETLQRLAMLACGVQAKSWRGCCNQRFVSPYRTPADLEVIQSKPGWCMLWRGKL
DSQ  ATGAGTGACGAAGATTGGCAGGTAAGTAGAAGACTCTTTGCAGTGCTCCAAGGAGGGGTATATAACGCTATGCTATATATATCTAGACTA---CCTCAGGACGAAAGAGAAAAATATAAAAAGGATTTCAAGAAAAGACTTTTAGATACAGAAACAGGATTTATAAAAAGACTAAGGAAAGCTGAAGGAATAAAATGGAGCTTTCATACTAGAGATTATCATGTAGGATATGTTAGAGAAATGGTAGCAGGACCCACTACACCACATAGTCTAAGGCTGTATGTGTATATAAGTAATCCACTATGGCATTCTCAGTATCGTCCAGGCTTGGTAAATTTTAATAAGGAATGGCCTTTTGTAAATCTATGGATAAAAACAGGATTTATGTGGGATGATATTGAAAAACAAAATATTTGTATAGGAGGAGAAGTTTCACCAGGATGGGGACCTGGGATGATAGGTATAGCGATAAAAGCTTTTAGTTGTGGCGAAAGAAAGATTGAGGCTACTCCTGTAATGATTATAAGAGGAGAAATAAATCCAAAAAAATGGTGTGGAGACTGTTGGAATTTGATGTGTCTTAGAAACTCACCTCCAGAGACTTTACAAAGGCTCGCTATGTTGGCATGTGGAGTACAGGCTAAGAGCTGGCGAGGATGCTGTAATCAACGTTTTGTTTCTCCTTACAGAACACCTGCTGATTTAGAGGTTATTCAATCCAAACCCGGCTGGTGCATGTTATGGCGAGGAAAACTG
TRN  10010101100011000
NAM  Q84810_9RETR/31-272
ASQ  LQDEYWHLNQ-LFVTYQIGIRTPSLWLTN-KDKLD----KFLLKKKLKHLEDKWVKQIRQADGIKWSLHTREWHTSLVKECVAGTG--NGLKLFVYIHSPLWR-EYRPNY-DWNPNWPYANCWISRKYMWDLDDSIKILSRNRPMEGWPPGWLGVVIKAFCCKECKYDWNPMEVIRQDIDPWDYCGDCWLFIVIRNTAPGSLQRLCMLQLGRPLLSWKCKSQCTFLDWRRTPLDALVIQDCLPWQWRVWMDL
DSQ  TTACAAGATGAGTATTGGCATTTGAATCAA---TTATTTGTAACTTATCAAATTGGGATTAGGACACCTAGTTTATGGCTTACTAAT---AAAGATAAATTGGAT------------AAATTCCTTTTGAAGAAAAAGTTAAAACATTTGGAAGATAAGTGGGTAAAACAAATCAGACAAGCAGATGGAATTAAATGGAGTCTGCATACTAGAGAATGGCATACTTCATTGGTTAAAGAATGTGTAGCAGGAACAGGA------AATGGATTAAAACTATTTGTTTATATTCATAGTCCTTTATGGAGA---GAGTATAGACCAAATTAT---GATTGGAATCCTAATTGGCCTTATGCAAATTGTTGGATATCAAGGAAATATATGTGGGACTTGGATGATTCTATTAAAATATTATCAAGAAATAGGCCAATGGAAGGATGGCCTCCAGGATGGTTAGGTGTAGTCATAAAAGCATTCTGTTGTAAAGAATGCAAGTATGATTGGAACCCTATGGAGGTCATAAGACAAGATATAGATCCTTGGGATTATTGTGGTGATTGTTGGCTATTTATAGTCATAAGAAACACAGCTCCAGGATCATTACAAAGACTATGTATGTTACAATTAGGAAGACCATTACTGTCTTGGAAATGTAAATCCCAATGTACATTTCTTGATTGGAGGAGAACACCTCTAGATGCATTAGTGATCCAAGATTGCCTACCTTGGCAATGGAGGGTGTGGATGGATTTA
TRN  10010101100011000
//