EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05836 - Chorion_S16)
FAM  PF05836
PID  Chorion_S16
DES  Chorion protein S16
IPR  IPR008450
ANO  7
ALN  157
AID  0.641386
APH  (O62607_CERCA/1-151:0.01297,(((CH16_DROVI/4-139:0.12688,CH16_DROGR/4-142:0.12208):0.10687,CH16_DROSU/4-140:0.09814):0.14557,(Q9VSP4_DROME/4-138:0.01719,CH16_DROME/4-138:0.00587):0.08274):0.77216,Q9NFX4_CERCA/1-151:0.00000);
ATP  (O62607_CERCA/1-151,(((CH16_DROVI/4-139,CH16_DROGR/4-142),CH16_DROSU/4-140),(Q9VSP4_DROME/4-138,CH16_DROME/4-138)),Q9NFX4_CERCA/1-151);
ATL  1.49047
DNO  7
DLN  471
DID  0.648185
DPH  (O62607_CERCA/1-151:0.00904,(((CH16_DROVI/4-139:0.08396,CH16_DROGR/4-142:0.12308):0.07976,CH16_DROSU/4-140:0.14846):0.08673,(Q9VSP4_DROME/4-138:0.00792,CH16_DROME/4-138:0.01222):0.11328):0.71415,Q9NFX4_CERCA/1-151:0.00196);
DTP  (O62607_CERCA/1-151,(((CH16_DROVI/4-139,CH16_DROGR/4-142),CH16_DROSU/4-140),(Q9VSP4_DROME/4-138,CH16_DROME/4-138)),Q9NFX4_CERCA/1-151);
DTL  1.3806
RID  0.641386
RPH  (O62607_CERCA/1-151:0.01297,(((CH16_DROVI/4-139:0.12688,CH16_DROGR/4-142:0.12208):0.10687,CH16_DROSU/4-140:0.09814):0.14557,(Q9VSP4_DROME/4-138:0.01719,CH16_DROME/4-138:0.00587):0.08274):0.77216,Q9NFX4_CERCA/1-151:0.00000);
RTP  (O62607_CERCA/1-151,(((CH16_DROVI/4-139,CH16_DROGR/4-142),CH16_DROSU/4-140),(Q9VSP4_DROME/4-138,CH16_DROME/4-138)),Q9NFX4_CERCA/1-151);
RTL  1.49047
LNK  CH16_DROGR/4-142:P24510:X53422
LNK  CH16_DROME/4-138:P22977:X16715
LNK  CH16_DROSU/4-140:P24511:X53423
LNK  CH16_DROVI/4-139:P24512:X53421
LNK  O62607_CERCA/1-151:O62607:Y08912
LNK  Q9NFX4_CERCA/1-151:Q9NFX4:AJ251919
LNK  Q9VSP4_DROME/4-138:Q9VSP4:AE003554
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9NFX4_CERCA/1-151
ASQ  MLRFMVCLVAMAVCICTSALASPQYGSAPTPAASSYGGSGGYAGAGASGAPAAQVIELPANVEAQAAALTNAAGAKATAAKINALKWDLLNLYGYEIGYPLLVKKYGPLTSLFSASLPPRSFVGKIDPAFLKDSYG------KIKYVGESSIGVAAI
DSQ  ATGCTCCGCTTCATGGTTTGCTTGGTCGCCATGGCCGTGTGTATATGCACATCCGCGTTGGCTTCTCCACAATATGGCAGCGCTCCAACTCCAGCAGCATCCTCGTATGGCGGAAGTGGTGGTTATGCCGGAGCCGGTGCGAGTGGCGCACCAGCAGCTCAGGTAATTGAATTGCCCGCCAATGTTGAAGCTCAAGCGGCTGCTTTGACAAATGCTGCCGGCGCTAAGGCGACAGCTGCCAAAATCAATGCACTCAAATGGGATTTGCTCAATTTGTACGGTTATGAAATCGGTTATCCATTGTTGGTGAAGAAATACGGACCATTGACCTCATTGTTCTCCGCCTCGTTGCCACCACGCAGTTTTGTTGGAAAGATCGATCCTGCTTTCTTGAAAGACTCTTACGGC------------------AAGATCAAATATGTCGGCGAAAGTTCGATCGGTGTTGCGGCTATT
TRN  10010101110011001
NAM  O62607_CERCA/1-151
ASQ  MLRFTVCLVATAVCICTSALASPQYGSAPTPAASSYGGSGGYAGAGASGAPAAQVIELPANVEAQAAALTNAAGAKATAAKINALKWDLLNLYGYEIGYPLLVKKYGPLTSLFSASLPPRSFVGKIDPAFLKDSYG------KIKYVGESSIGVAAI
DSQ  ATGCTCCGCTTCACGGTTTGCTTGGTGGCCACGGCCGTGTGTATATGCACATCCGCGTTGGCTTCTCCACAATATGGCAGCGCTCCAACTCCAGCAGCATCCTCGTATGGCGGGAGTGGTGGTTATGCCGGTGCCGGTGCGAGTGGCGCACCAGCAGCTCAGGTAATTGAATTGCCCGCCAATGTTGAAGCTCAAGCGGCTGCTTTGACAAATGCTGCCGGCGCTAAGGCGACAGCTGCCAAAATCAATGCACTCAAATGGGATTTGCTCAATTTGTACGGTTATGAAATCGGTTATCCATTGTTGGTGAAGAAATACGGACCATTGACCTCATTGTTCTCCGCCTCGTTGCCACCACGCAGTTTTGTTGGAAAGATCGATCCTGCTTTCTTGAAAGACTCTTACGGC------------------AAGATCAAATATGTCGGCGAAAGTTCGATCGGTGTTGCGGCTATT
TRN  10010101110011001
NAM  CH16_DROVI/4-139
ASQ  NYMRLLCLM--ACCFSVCLAY-----------RPSGNSYR--------SGGYGEYIKPVETAEAQAAALTNAAGAAASSAKLDGADWYALNRYGWEQGKPLLVKPYGPLDNLYAAALPPRAFVAEIDPVFKRNSYGGAYGERTVTLNTGSKLAVSAA
DSQ  AACTACATGCGTCTGCTTTGCCTGATG------GCCTGCTGCTTCTCCGTCTGCCTGGCCTAC---------------------------------AGGCCCAGCGGCAACAGCTACCGC------------------------AGCGGCGGCTATGGCGAATATATCAAGCCCGTCGAAACCGCCGAGGCTCAAGCGGCTGCTCTCACCAATGCTGCCGGCGCTGCTGCCTCCTCCGCCAAATTGGATGGTGCCGATTGGTATGCACTGAACCGTTATGGCTGGGAACAGGGCAAGCCACTGCTGGTCAAGCCATACGGCCCGCTGGACAACCTCTATGCCGCTGCTTTGCCACCACGCGCCTTCGTCGCCGAGATCGATCCAGTCTTCAAGAGGAACAGCTATGGCGGTGCATATGGCGAGAGGACTGTCACCCTGAACACCGGCTCCAAGCTGGCTGTCTCTGCTGCC
TRN  10010101100011011
NAM  CH16_DROGR/4-142
ASQ  NYMRLLCLM--ACCLSICLAY--------GPVRPIVNRYGR--------GRVIDVVKPVDTAEAQAAALTNAAGAAAASAKLDGANWYALNRYGWEQGRPLLSKPYGPLDKLYAAALPPRSFVAEIDPVFKKSNYGGLYGDKTITLNTGAKLAVSVA
DSQ  AACTATATGCGTCTGCTCTGCCTGATG------GCCTGCTGCCTCTCCATCTGCCTGGCTTAC------------------------GGACCCGTCAGACCCATCGTCAATCGTTATGGTAGG------------------------GGTCGTGTTATCGACGTTGTCAAGCCCGTCGACACCGCTGAGGCTCAGGCAGCTGCTCTGACCAATGCTGCTGGTGCTGCTGCCGCCTCGGCCAAATTGGATGGTGCCAATTGGTATGCATTGAACCGTTATGGCTGGGAGCAGGGCCGTCCTCTGCTGTCCAAGCCTTATGGCCCTCTGGACAAGCTCTATGCCGCTGCATTGCCACCACGCTCGTTCGTTGCTGAGATCGATCCAGTCTTCAAGAAGAGCAACTATGGCGGTCTCTATGGCGATAAGACAATCACTTTGAACACTGGTGCCAAACTGGCAGTGTCTGTTGCT
TRN  10010101100011011
NAM  Q9VSP4_DROME/4-138
ASQ  T-LRLLCLM--ACCVALAVAN-----------RPNYGGSG-Y------GASYGDVVKAAETAEAQASALTNAAGAAASAAKLDGADWNSLNRYGWEQGRPLLAKPYGPLDPLYAAALPPRSFVAEVDPVFKKSQYGGSYGENAY-LKTDAKLGVVAI
DSQ  ACC---CTACGTCTTCTCTGCCTGATG------GCCTGCTGCGTCGCCCTGGCTGTGGCCAAT---------------------------------CGCCCCAACTACGGCGGATCCGGA---TAC------------------GGAGCCAGCTACGGCGATGTGGTTAAGGCCGCTGAGACCGCCGAGGCTCAGGCTTCTGCCCTGACCAACGCTGCCGGAGCAGCTGCCTCCGCCGCCAAGCTGGACGGTGCTGACTGGAATTCCCTCAACCGTTATGGATGGGAGCAGGGTCGCCCACTTTTGGCCAAGCCCTACGGCCCTCTGGACCCGCTATACGCTGCTGCTCTGCCACCACGCTCCTTCGTGGCTGAGGTCGATCCAGTCTTCAAGAAGAGCCAATACGGCGGATCTTACGGCGAGAATGCGTAC---CTGAAGACCGACGCCAAACTGGGTGTTGTGGCCATC
TRN  11011101101011011
NAM  CH16_DROME/4-138
ASQ  T-LRLLCLM--ACCVALAVAN-----------RPHYGGSG-Y------GASYGDVVKAAETAEAQASALTNAAGAAASAAKLDGADWYALNRYGWEQGRPLLAKPYGPLDPLYAAALPPRSFVAEVDPVFKKSQYGGSYGENAY-LKTDAKLGVVAI
DSQ  ACC---CTACGCCTTCTCTGCCTGATG------GCCTGCTGCGTCGCCCTGGCTGTGGCCAAT---------------------------------CGCCCCCACTACGGCGGATCCGGA---TAC------------------GGAGCCAGCTACGGCGATGTGGTTAAGGCCGCTGAGACCGCCGAGGCTCAGGCTTCTGCCCTGACCAACGCCGCCGGAGCAGCTGCCTCCGCCGCCAAGCTGGACGGTGCTGACTGGTATGCCCTCAACCGTTACGGATGGGAGCAGGGTCGCCCACTTCTGGCCAAGCCCTACGGTCCTCTGGACCCGCTATACGCTGCTGCTCTGCCACCACGCTCCTTCGTGGCTGAGGTCGATCCAGTCTTCAAGAAGAGCCAATACGGCGGATCTTACGGCGAGAATGCGTAC---CTGAAGACCGACGCCAAACTGGGTGTTGTGGCCATC
TRN  11011101101011011
NAM  CH16_DROSU/4-140
ASQ  NNMRLLCLL-LACYISAIVAH-----------RPSYRSSG--------SDRYVDVVRASETAEAQAAALTNAAGAAASAAKLDGADWYALNRYGWEQGRPLLAKPYGPLDNLYAAALPPRSFVAEIDPVFKKSHYGGAYGGKSVTLNTGAKVAVAAL
DSQ  AACAACATGCGTCTCCTCTGCCTGCTC---TTGGCCTGCTACATCTCCGCCATTGTGGCCCAC---------------------------------AGGCCCAGCTACCGCTCCTCCGGC------------------------TCCGATCGCTACGTGGATGTGGTCCGCGCATCCGAAACGGCCGAGGCCCAGGCCGCTGCCCTCACCAATGCCGCTGGTGCTGCCGCCTCTGCCGCGAAATTGGACGGTGCCGATTGGTATGCCCTCAACCGTTATGGCTGGGAGCAGGGCAGGCCTCTGCTGGCCAAGCCTTATGGTCCCCTGGACAATCTCTATGCCGCTGCCCTGCCACCCCGTTCCTTCGTGGCTGAAATCGATCCAGTCTTCAAGAAGAGCCACTATGGTGGAGCTTATGGAGGCAAGAGCGTGACGCTCAACACTGGCGCCAAGGTGGCTGTCGCAGCGCTG
TRN  10010101100011011
//