EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05826 - Phospholip_A2_2)
FAM  PF05826
PID  Phospholip_A2_2
DES  Phospholipase A2
IPR  IPR008774
ANO  9
ALN  103
AID  0.430191
APH  ((((Q8SZ42_DROME/135-234:0.57504,Q8MR17_DROME/108-208:0.46405):0.16253,((PA2_APIME/35-135:0.30653,PA2_BOMTE/2-102:0.24440):0.37394,(PA23_HELSU/4-103:0.16796,PA2G3_HUMAN/152-251:0.46188):0.23239):0.18813):0.08834,Q8SXC6_DROME/42-141:0.46253):0.38829,Q9V4L2_DROME/44-143:0.34750,Q9V4L3_DROME/27-125:0.38903);
ATP  ((((Q8SZ42_DROME/135-234,Q8MR17_DROME/108-208),((PA2_APIME/35-135,PA2_BOMTE/2-102),(PA23_HELSU/4-103,PA2G3_HUMAN/152-251))),Q8SXC6_DROME/42-141),Q9V4L2_DROME/44-143,Q9V4L3_DROME/27-125);
ATL  4.85486
DNO  7
DLN  309
DID  0.505007
DPH  ((Q9V4L2_DROME/44-143:0.32901,Q9V4L3_DROME/27-125:0.24529):0.20519,(Q8SXC6_DROME/42-141:0.37373,PA2_APIME/35-135:0.42358):0.07680,((Q8MR17_DROME/108-208:0.39128,Q8SZ42_DROME/135-234:0.29665):0.11372,PA2G3_HUMAN/152-251:0.38243):0.09628);
DTP  ((Q9V4L2_DROME/44-143,Q9V4L3_DROME/27-125),(Q8SXC6_DROME/42-141,PA2_APIME/35-135),((Q8MR17_DROME/108-208,Q8SZ42_DROME/135-234),PA2G3_HUMAN/152-251));
DTL  2.93396
RID  0.412137
RPH  (((Q8SZ42_DROME/135-234:0.57331,Q8MR17_DROME/108-208:0.48515):0.16390,((PA2_APIME/35-135:0.51889,PA2G3_HUMAN/152-251:0.56950):0.28625,Q8SXC6_DROME/42-141:0.38347):0.09508):0.41922,Q9V4L2_DROME/44-143:0.41183,Q9V4L3_DROME/27-125:0.33390);
RTP  (((Q8SZ42_DROME/135-234,Q8MR17_DROME/108-208),((PA2_APIME/35-135,PA2G3_HUMAN/152-251),Q8SXC6_DROME/42-141)),Q9V4L2_DROME/44-143,Q9V4L3_DROME/27-125);
RTL  4.25795
LNK  PA23_HELSU/4-103:P16354:
LNK  PA2_APIME/35-135:P00630:AF438408
LNK  PA2_BOMTE/2-102:P82971:
LNK  PA2G3_HUMAN/152-251:Q9NZ20:AF220490
LNK  Q8MR17_DROME/108-208:Q8MR17:AY122184
LNK  Q8SXC6_DROME/42-141:Q8SXC6:AY094683
LNK  Q8SZ42_DROME/135-234:Q8SZ42:AY071131
LNK  Q9V4L2_DROME/44-143:Q9V4L2:AE003841
LNK  Q9V4L3_DROME/27-125:Q9V4L3:AE003841
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9V4L3_DROME/27-125
ASQ  TVPGTKWCGPGNIAA-NYDDLGTEREVDTCCRAHDNCEEKIPPLEEAFGL-RNDGFFPIFSCACESAFRNCLTALRNG-HSLALGKIYFNTKEV-CFGYGHPI
DSQ  ACAGTTCCGGGCACAAAGTGGTGTGGACCCGGGAACATAGCAGCC---AACTACGATGACCTGGGCACTGAGCGCGAAGTGGACACGTGCTGCCGGGCGCACGACAACTGTGAGGAGAAGATTCCGCCGCTGGAGGAAGCCTTTGGCCTG---AGAAACGACGGGTTTTTCCCCATATTCTCGTGTGCCTGCGAGTCGGCCTTCCGGAACTGCCTCACCGCTCTGCGAAACGGA---CACTCCCTGGCTCTTGGCAAAATCTACTTCAACACCAAGGAGGTG---TGCTTTGGCTACGGGCATCCCATC
TRN  10010101100011011
NAM  Q9V4L2_DROME/44-143
ASQ  TVPGTKWCGPGNTAA-NFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQFINCLQAVNSI-TAKTLGRIYYGS-RSRCFANGHPT
DSQ  ACGGTGCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGGCG---AACTTCGAGGATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGTGCCCACGACCATTGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGGACTGCCCACCAACACAGACTGGTTTCCCATCCTCAAGTGCACCTGCGAGCAGCAGTTTATCAATTGCCTGCAGGCAGTGAACAGCATC---ACGGCCAAAACTCTGGGTCGTATCTACTATGGCAGC---AGGAGCAGGTGCTTTGCCAACGGACATCCCACC
TRN  10010101100011011
NAM  PA2G3_HUMAN/152-251
ASQ  TMPGTLWCGVGDSA-GNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGI-RNYRFHTISHCDCDTRFQQCLQNQHDSI-SDIVGVAFFNVLEIPCFVLEEQE
DSQ  ACCATGCCTGGCACACTGTGGTGTGGAGTTGGAGATTCTGCT---GGGAACTCCTCGGAGCTGGGGGTCTTCCAGGGACCTGATCTCTGTTGCCGGGAACATGACCGCTGCCCACAGAACATCTCACCCTTGCAGTACAACTATGGCATC---CGAAACTACCGATTCCACACCATCTCCCACTGTGACTGTGACACCAGGTTTCAGCAATGCCTACAGAATCAGCACGACTCCATC---TCGGACATCGTGGGCGTGGCCTTCTTCAACGTGCTGGAGATCCCCTGCTTTGTGCTGGAGGAGCAGGAG
TRN  10010101100011001
NAM  PA23_HELSU/4-103
ASQ  IMPGTLWCGAGNAAS-DYSQLGTEKDTDMCCRDHDHCENWISALEYKHGM-RNYYPSTISHCDCDNQFRSCLMKLKDG-TADYVGQTYFNVLKIPCFELEEGE
NAM  PA2_BOMTE/2-102
ASQ  IFPGTLWCGNGNLAN-GTNQLGSWKETDSCCRTHDMCPDLIEAHGSKHGL-TNAADYTRLSCECDEEFRRCLHNSGDTVSAGFVGRTYFTVLHTQCFRLDYPI
NAM  PA2_APIME/35-135
ASQ  IYPGTLWCGHGNKSS-GPNELGRFKHTDACCRTHDMCPDVMSAGESKHGL-TNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPV
DSQ  ATATATCCAGGAACGTTATGGTGCGGGCATGGTAACAAGTCGTCC---GGCCCGAACGAGCTAGGTCGGTTCAAGCACACGGATGCATGCTGTCGAACCCACGACATGTGCCCGGACGTGATGTCAGCTGGTGAATCGAAGCACGGCCTG---ACCAACACGGCCTCCCACACCAGGTTGTCGTGCGACTGCGACGACAAGTTCTATGATTGTCTTAAAAATTCGGCGGACACGATTAGCTCGTATTTCGTAGGGAAGATGTACTTCAATCTGATAGACACGAAGTGTTACAAACTGGAGCATCCTGTC
TRN  10010101100011000
NAM  Q8SZ42_DROME/135-234
ASQ  IIPGTKWCGTGDIAE-TYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYEL-MNDSLYTKSHCICDDMLFSCLKMTNTS-ASQLMGSIYFNLVQVPCLDGRSNH
DSQ  ATTATACCAGGCACAAAATGGTGTGGCACCGGCGACATTGCAGAG---ACGTACAGCGATCTGGGCAGCGAAATGGCCATGGATCGATGCTGTCGGCAACACGATCTCTGCCCCATCAAAATCCGAGCCTATCAAAACAAATACGAACTG---ATGAACGATTCGCTGTACACAAAATCCCACTGCATTTGCGACGACATGCTGTTCTCCTGCCTGAAGATGACCAACACCTCG---GCCTCGCAGCTGATGGGCTCCATCTACTTTAATCTGGTGCAGGTGCCGTGTCTGGACGGGCGGAGCAATCAT
TRN  10010101100011011
NAM  Q8SXC6_DROME/42-141
ASQ  IYPGTKWCGPGTAAT-SYDDLGAHAREDRCCREHDMCPDVLNVGECRRGL-CNRGTFTRSHCDCDARFRRCLQAANTE-TANTLGAIFYNVVQVTCFQERSPC
DSQ  ATCTATCCGGGCACAAAGTGGTGCGGACCGGGCACAGCGGCCACC---AGCTACGACGATCTCGGTGCGCACGCTCGCGAGGATCGCTGCTGTCGCGAGCACGACATGTGTCCCGATGTGCTAAATGTGGGCGAATGCAGGCGAGGATTG---TGCAATCGCGGCACATTCACGAGAAGCCACTGCGATTGCGATGCCCGGTTCAGGCGATGCTTGCAGGCGGCAAACACGGAG---ACGGCCAATACGCTGGGCGCCATCTTCTACAATGTGGTGCAGGTGACGTGCTTCCAGGAGCGGAGTCCCTGC
TRN  10010101100011011
NAM  Q8MR17_DROME/108-208
ASQ  IAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSNRYDL-FNYRPYTLSHCSCDLRFRTCLKMAGDE-DANAIGKLFFNVVQTQCFGLKAET
DSQ  ATTGCGCCCAACACGCGGTGGTGCGGACGCGGCAATCTGGCCAATGGAACGTACAACGATCTGGGCGGCGCTTCCAAGGCGGACAAATGCTGCCGGAAGCATGATCACTGCAAAATGTGGATCGATGGCATGTCCAATCGCTATGATCTC---TTCAACTATCGACCGTACACGCTGTCACACTGCAGCTGTGATCTACGGTTCCGCACGTGTCTGAAGATGGCCGGCGACGAG---GATGCGAACGCCATCGGAAAGCTCTTCTTCAATGTCGTGCAGACGCAGTGTTTCGGCCTGAAGGCCGAGACC
TRN  11011101101011001
//