EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05825 - PSP94)
FAM  PF05825
PID  PSP94
DES  Beta-microseminoprotein (PSP-94)
IPR  IPR008735
ANO  7
ALN  114
AID  0.564444
APH  ((MSPA_SAGOE/1-112:0.12053,MSMB_HUMAN/1-114:0.19394):0.04675,(MSPE_SAGOE/1-114:0.24988,MSPJ_SAGOE/1-114:0.13471):0.05305,(MSMB_PIG/1-111:0.29443,(MSMB_MOUSE/1-113:0.37468,MSMB_RAT/1-113:0.12974):0.50309):0.23521);
ATP  ((MSPA_SAGOE/1-112,MSMB_HUMAN/1-114),(MSPE_SAGOE/1-114,MSPJ_SAGOE/1-114),(MSMB_PIG/1-111,(MSMB_MOUSE/1-113,MSMB_RAT/1-113)));
ATL  2.33601
DNO  7
DLN  342
DID  0.695269
DPH  (MSPJ_SAGOE/1-114:0.08289,MSPE_SAGOE/1-114:0.10345,(((MSMB_PIG/1-111:0.14592,(MSMB_MOUSE/1-113:0.19861,MSMB_RAT/1-113:0.06454):0.27757):0.15118,MSMB_HUMAN/1-114:0.06697):0.03330,MSPA_SAGOE/1-112:0.07691):0.02995);
DTP  (MSPJ_SAGOE/1-114,MSPE_SAGOE/1-114,(((MSMB_PIG/1-111,(MSMB_MOUSE/1-113,MSMB_RAT/1-113)),MSMB_HUMAN/1-114),MSPA_SAGOE/1-112));
DTL  1.23129
RID  0.564444
RPH  ((MSPA_SAGOE/1-112:0.12053,MSMB_HUMAN/1-114:0.19394):0.04675,(MSPE_SAGOE/1-114:0.24988,MSPJ_SAGOE/1-114:0.13471):0.05305,(MSMB_PIG/1-111:0.29443,(MSMB_MOUSE/1-113:0.37468,MSMB_RAT/1-113:0.12974):0.50309):0.23521);
RTP  ((MSPA_SAGOE/1-112,MSMB_HUMAN/1-114),(MSPE_SAGOE/1-114,MSPJ_SAGOE/1-114),(MSMB_PIG/1-111,(MSMB_MOUSE/1-113,MSMB_RAT/1-113)));
RTL  2.33601
LNK  MSMB_HUMAN/1-114:P08118:M34376
LNK  MSMB_MOUSE/1-113:O08540:U89840
LNK  MSMB_PIG/1-111:O02826:S80724
LNK  MSMB_RAT/1-113:P97580:U65486
LNK  MSPA_SAGOE/1-112:O97936:AJ010158
LNK  MSPE_SAGOE/1-114:O97935:AJ010154
LNK  MSPJ_SAGOE/1-114:O97949:AJ010155
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MSMB_RAT/1-113
ASQ  MKARLGSLLVLATLVTASNAACSIQRLKRLPNEKSDECTDVDGGKHVLNTYWQ-KNCEWCFCEKTAITCCTKTLIPVSYDKKRCQRQFHSENCTYSVVERTNPGKTCPVNGWTI
DSQ  ATGAAAGCTCGGCTGGGCAGCCTCCTAGTCCTTGCCACCTTGGTGACAGCATCCAATGCAGCGTGCTCTATTCAAAGACTCAAGAGACTTCCAAACGAAAAGTCTGATGAATGTACAGATGTAGACGGTGGCAAGCACGTCCTTAACACTTACTGGCAG---AAGAACTGTGAGTGGTGTTTCTGTGAAAAAACTGCGATCACCTGCTGCACCAAAACTCTTATACCCGTGAGCTATGACAAAAAGAGGTGTCAGAGACAATTCCACTCAGAGAACTGCACCTATAGTGTGGTGGAACGGACGAACCCAGGAAAGACCTGTCCAGTCAATGGCTGGACAATA
TRN  10010101100011001
NAM  MSMB_MOUSE/1-113
ASQ  MEAWLGSLLFLATMVIASKAVCSIENREIFPNQMSDDCMDADGNKHFLNTPWK-KNCTWCSCDKTSITCCTNATRPLSYDKDNCDVQFHPENCTYSVVDRKNPGKTCRVDSWTM
DSQ  ATGGAAGCTTGGCTGGGCAGTCTCTTATTCCTTGCTACCATGGTGATAGCATCCAAAGCAGTATGTTCTATTGAAAATCGTGAGATATTTCCAAATCAAATGTCTGATGACTGCATGGATGCTGATGGTAACAAGCATTTCCTTAACACTCCCTGGAAG---AAGAACTGCACGTGGTGTTCATGTGACAAAACGTCAATCACCTGCTGTACCAACGCTACTAGGCCTTTGAGCTATGACAAAGACAACTGTGATGTACAATTCCACCCAGAGAACTGCACCTACAGTGTGGTGGATCGGAAGAACCCAGGGAAGACCTGTCGAGTTGACAGCTGGACTATG
TRN  10010101100011000
NAM  MSMB_HUMAN/1-114
ASQ  MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
DSQ  ATGAATGTTCTCCTGGGCAGCGTTGTGATCTTTGCCACCTTCGTGACTTTATGCAATGCATCATGCTATTTCATACCTAATGAGGGAGTTCCAGGAGATTCAACCAGGAAATGCATGGATCTCAAAGGAAACAAACACCCAATAAACTCGGAGTGGCAGACTGACAACTGTGAGACATGCACTTGCTACGAAACAGAAATTTCATGTTGCACCCTTGTTTCTACACCTGTGGGTTATGACAAAGACAACTGCCAAAGAATCTTCAAGAAGGAGGACTGCAAGTATATCGTGGTGGAGAAGAAGGACCCAAAAAAGACCTGTTCTGTCAGTGAATGGATAATC
TRN  10010101100011000
NAM  MSPJ_SAGOE/1-114
ASQ  MNVLLGGLVIFATFVTLCNASCYIILNDMIPGDSTNECTDLKGNKHPINSKWRTDNCDSCTCREKEISCCTLVSTPVGYDTHKCQKIFNKEDCRISVVEKNDPSKTCEVNAWIM
DSQ  ATGAACGTTCTCCTGGGCGGCCTTGTGATCTTTGCCACCTTTGTGACTTTATGCAATGCATCATGCTATATAATACTGAATGACATGATTCCAGGAGACTCAACCAACGAATGCACAGATCTGAAAGGAAACAAACATCCAATAAATTCAAAGTGGCGGACTGACAACTGTGACTCATGTACTTGCCGAGAAAAAGAAATATCATGTTGCACTCTTGTTTCTACGCCGGTGGGTTATGACACACACAAGTGCCAGAAAATCTTCAACAAGGAGGACTGCAGGATAAGTGTGGTGGAGAAGAATGACCCAAGTAAGACCTGTGAAGTCAATGCATGGATAATG
TRN  10010101100011000
NAM  MSPA_SAGOE/1-112
ASQ  -NVLLGGLVIFATFVTLCNGSCYLMPNKMVPGDSTKECTDLKGNKHPLNSRWKTENCDECDCLEKEISCCSLVAIPVGYDQDNCQKIFKQEDCKYIVVEKKDPNKTCEVTQWI-
DSQ  ---AACGTTCTCCTGGGCGGCCTTGTGATCTTTGCTACCTTTGTGACTTTATGCAATGGATCATGCTATTTAATGCCCAATAAGATGGTTCCAGGAGACTCAACCAAGGAATGCACGGATCTCAAAGGAAACAAACACCCATTAAACTCAAGGTGGAAGACTGAGAACTGTGATGAATGTGATTGCCTCGAAAAAGAAATATCGTGTTGCTCCCTTGTTGCTATACCTGTGGGTTACGACCAAGACAACTGCCAGAAAATCTTCAAGCAAGAGGACTGCAAGTATATTGTGGTGGAGAAGAAAGACCCAAATAAGACCTGTGAAGTCACTCAATGGATA---
TRN  10010101100011000
NAM  MSPE_SAGOE/1-114
ASQ  MNVLLGGLVIFATFVTLCNGSCYVIRHKIVPGETIKECTDLKGNKHPLDSRWRTEDCELCACRDIEISCCSLVSTPVGYDRHNCRKIFNKETCKISVVEKTDPNRPCGVSGWIS
DSQ  ATGAACGTTCTCCTGGGCGGCCTTGTGATCTTTGCCACCTTTGTGACTTTATGCAATGGATCATGCTATGTAATACGTCATAAGATAGTTCCAGGAGAGACAATCAAAGAATGCACGGATCTCAAAGGAAACAAACACCCGCTGGACTCAAGGTGGCGGACTGAAGACTGTGAGCTATGTGCTTGCCGTGACATAGAAATATCGTGTTGCTCCCTTGTTTCTACACCTGTGGGTTATGACAGACACAACTGCCGGAAAATCTTCAACAAGGAGACCTGCAAGATAAGTGTGGTGGAGAAGACGGACCCAAATAGGCCCTGTGGTGTCAGCGGATGGATATCG
TRN  10010101100011000
NAM  MSMB_PIG/1-111
ASQ  MKFLLGTLVVLATFVTLCNSQCYFIPNQSL---KPNECQDLKGVSHPLNSVWKTKDCEECTCGQNAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
DSQ  ATGAAATTTCTTCTGGGCACCCTCGTGGTCTTAGCCACCTTTGTGACTTTATGCAACTCCCAGTGCTATTTCATACCTAATCAGAGCTTA---------AAACCTAATGAATGCCAGGATCTTAAAGGAGTCTCACACCCGCTGAACTCTGTGTGGAAGACTAAAGACTGTGAGGAGTGTACTTGTGGCCAAAATGCGATTAGCTGTTGCAACACTGCTGCCATACCTACGGGTTATGACACAAATAAGTGTCAGAAAATCTTGAACAAGAAGACCTGCACCTATACAGTGGTGGAAAAGAAGGACCCAGGAAAGACCTGTGATGTCACTGGATGGGTATTA
TRN  10010101100011000
//