EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05824 - Pro-MCH)
FAM  PF05824
PID  Pro-MCH
DES  Pro-melanin-concentrating hormone (Pro-MCH)
IPR  IPR005456
ANO  4
ALN  86
AID  0.760074
APH  ((MLCH_HUMAN/80-165:0.00000,MLCH_RAT/80-165:0.13948):0.24149,MLC2_HUMAN/1-86:0.00000,Q9BQC4_HUMAN/1-82:0.17090);
ATP  ((MLCH_HUMAN/80-165,MLCH_RAT/80-165),MLC2_HUMAN/1-86,Q9BQC4_HUMAN/1-82);
ATL  0.55187
DNO  4
DLN  258
DID  0.822178
DPH  ((MLC2_HUMAN/1-86:0.00000,Q9BQC4_HUMAN/1-82:0.11250):0.12696,MLCH_HUMAN/80-165:0.00022,MLCH_RAT/80-165:0.13901);
DTP  ((MLC2_HUMAN/1-86,Q9BQC4_HUMAN/1-82),MLCH_HUMAN/80-165,MLCH_RAT/80-165);
DTL  0.37875
RID  0.760074
RPH  ((MLCH_HUMAN/80-165:0.00000,MLCH_RAT/80-165:0.13948):0.24149,MLC2_HUMAN/1-86:0.00000,Q9BQC4_HUMAN/1-82:0.17090);
RTP  ((MLCH_HUMAN/80-165,MLCH_RAT/80-165),MLC2_HUMAN/1-86,Q9BQC4_HUMAN/1-82);
RTL  0.55187
LNK  MLC2_HUMAN/1-86:Q16048:AY008411
LNK  MLCH_HUMAN/80-165:P20382:S63697
LNK  MLCH_RAT/80-165:P14200:M29712
LNK  Q9BQC4_HUMAN/1-82:Q9BQC4:AY008410
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9BQC4_HUMAN/1-82
ASQ  MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFD----IFSDHFYQNINL
DSQ  ATGCTGTCACAAAAACCAAAGAAAAAACATAATTTCTTAAATCATGGTCTGTCACTGAATCTGGTTATAAAACCTTATCTTGCACTAGAAGGATCTGTAGCTTTTCCAGCTGAGAATGGGGTTCAGGATACCGAATCAACACAAGAAAAGAGAGAAACTGGGGATGAAGAAAACTCAGCTAAATTTCCTGTAGGAAGGAGAGATTTTGAC------------ATATTCTCAGACCACTTCTACCAAAACATAAATCTG
TRN  10010101100011000
NAM  MLC2_HUMAN/1-86
ASQ  MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV
DSQ  ATGCTGTCACAAAAACCAAAGAAAAAACATAATTTCTTAAATCATGGTCTGTCACTGAATCTGGTTATAAAACCTTATCTTGCACTAGAAGGATCTGTAGCTTTTCCAGCTGAGAATGGGGTTCAGGATACCGAATCAACACAAGAAAAGAGAGAAACTGGGGATGAAGAAAACTCAGCTAAATTTCCTGTAGGAAGGAGAGATTTTGACACACTCAGCTGTATGCTGGGAAGAGTCTACCAATCTTGCTGGCAAGTC
TRN  10010101100011000
NAM  MLCH_HUMAN/80-165
ASQ  KVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVDFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
DSQ  AAAGTTTCAAAGAACACAGGCTCCAAACATAACTTCTTAAATCATGGTCTGCCACTGAATCTGGCTATAAAACCTTATCTTGCACTAAAAGGATCTGTAGCTTTCCCAGCTGAGAATGGAGTTCAGAATACTGAATCAACACAAGAAAAGAGAGAAATTGGGGATGAAGAAAACTCAGCTAAATTTCCTATAGGAAGGAGAGATTTTGACATGCTCAGATGTATGCTGGGAAGAGTCTACCGACCTTGTTGGCAAGTC
TRN  10010101100011000
NAM  MLCH_RAT/80-165
ASQ  KTTKNTGSKQNLVTHGLPLSLAVKPYLALKGPAVFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
DSQ  AAGACCACAAAGAACACAGGCTCCAAGCAGAATCTCGTAACTCACGGTCTGCCCCTCAGTCTGGCTGTAAAACCTTACCTCGCTCTGAAAGGACCAGCAGTCTTCCCAGCTGAGAATGGAGTTCAGAATACTGAGTCCACACAGGAAAAGAGGGAAATTGGGGATGAAGAAAACTCAGCTAAATTTCCCATAGGAAGGAGAGATTTTGACATGCTCAGGTGTATGCTGGGACGAGTCTACCGACCCTGTTGGCAAGTC
TRN  10010101100011001
//