EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05715 - zf-piccolo)
FAM  PF05715
PID  zf-piccolo
DES  Piccolo Zn-finger
IPR  IPR008899
ANO  12
ALN  62
AID  0.649831
APH  ((((((((BSN_MOUSE/162-222:0.00000,BSN_HUMAN/165-225:0.00000):0.00000,BSN_RAT/162-222:0.01538):0.24909,(PCLO_CHICK/364-425:0.14510,(PCLO_RAT/519-580:0.01637,PCLO_MOUSE/498-559:0.00000):0.01916):0.11132):0.39240,PCLO_RAT/1006-1066:0.00000):0.03474,PCLO_MOUSE/963-1023:0.00000):0.06171,PCLO_CHICK/832-892:0.19553):0.32013,BSN_HUMAN/460-520:0.08914):0.00442,BSN_MOUSE/459-519:0.03729,BSN_RAT/457-517:0.03553);
ATP  ((((((((BSN_MOUSE/162-222,BSN_HUMAN/165-225),BSN_RAT/162-222),(PCLO_CHICK/364-425,(PCLO_RAT/519-580,PCLO_MOUSE/498-559))),PCLO_RAT/1006-1066),PCLO_MOUSE/963-1023),PCLO_CHICK/832-892),BSN_HUMAN/460-520),BSN_MOUSE/459-519,BSN_RAT/457-517);
ATL  1.76138
DNO  12
DLN  186
DID  0.656234
DPH  ((((((BSN_MOUSE/162-222:0.00602,BSN_RAT/162-222:0.01103):0.02998,BSN_HUMAN/165-225:0.02139):0.22050,(PCLO_CHICK/364-425:0.16683,(PCLO_RAT/519-580:0.01102,PCLO_MOUSE/498-559:0.03357):0.05199):0.15173):0.22758,(PCLO_CHICK/832-892:0.21445,(PCLO_RAT/1006-1066:0.04072,PCLO_MOUSE/963-1023:0.01089):0.08361):0.09451):0.27843,BSN_RAT/457-517:0.03230):0.00511,BSN_MOUSE/459-519:0.05046,BSN_HUMAN/460-520:0.07428);
DTP  ((((((BSN_MOUSE/162-222,BSN_RAT/162-222),BSN_HUMAN/165-225),(PCLO_CHICK/364-425,(PCLO_RAT/519-580,PCLO_MOUSE/498-559))),(PCLO_CHICK/832-892,(PCLO_RAT/1006-1066,PCLO_MOUSE/963-1023))),BSN_RAT/457-517),BSN_MOUSE/459-519,BSN_HUMAN/460-520);
DTL  1.81641
RID  0.649831
RPH  ((((((((BSN_MOUSE/162-222:0.00000,BSN_HUMAN/165-225:0.00000):0.00000,BSN_RAT/162-222:0.01538):0.24909,(PCLO_CHICK/364-425:0.14510,(PCLO_RAT/519-580:0.01637,PCLO_MOUSE/498-559:0.00000):0.01916):0.11132):0.39240,PCLO_RAT/1006-1066:0.00000):0.03474,PCLO_MOUSE/963-1023:0.00000):0.06171,PCLO_CHICK/832-892:0.19553):0.32013,BSN_HUMAN/460-520:0.08914):0.00442,BSN_MOUSE/459-519:0.03729,BSN_RAT/457-517:0.03553);
RTP  ((((((((BSN_MOUSE/162-222,BSN_HUMAN/165-225),BSN_RAT/162-222),(PCLO_CHICK/364-425,(PCLO_RAT/519-580,PCLO_MOUSE/498-559))),PCLO_RAT/1006-1066),PCLO_MOUSE/963-1023),PCLO_CHICK/832-892),BSN_HUMAN/460-520),BSN_MOUSE/459-519,BSN_RAT/457-517);
RTL  1.76138
LNK  BSN_HUMAN/165-225:Q9UPA5:AF052224
LNK  BSN_HUMAN/460-520:Q9UPA5:AF052224
LNK  BSN_MOUSE/162-222:O88737:Y17034
LNK  BSN_MOUSE/459-519:O88737:Y17034
LNK  BSN_RAT/162-222:O88778:Y16563
LNK  BSN_RAT/457-517:O88778:Y16563
LNK  PCLO_CHICK/364-425:Q9PU36:Y19187
LNK  PCLO_CHICK/832-892:Q9PU36:Y19187
LNK  PCLO_MOUSE/498-559:Q9QYX7:Y19185
LNK  PCLO_MOUSE/963-1023:Q9QYX7:Y19185
LNK  PCLO_RAT/1006-1066:Q9JKS6:AF138789
LNK  PCLO_RAT/519-580:Q9JKS6:AF138789
AMK  xxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PCLO_MOUSE/963-1023
ASQ  PKPACPLCRTEL.NVGSQDPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAI
DSQ  CCCAAACCGGCCTGTCCTCTCTGCAGAACGGAACTC...AACGTAGGGTCTCAGGATCCTCCCAACTTCAACACCTGCACAGAATGCAAGAATCAAGTTTGCAATCTCTGTGGATTTAACCCAACGCCCCACCTGACTGAGATTCAAGAATGGCTTTGTTTAAACTGTCAGACACAGAGAGCAATA
TRN  10010101100011010
NAM  PCLO_RAT/1006-1066
ASQ  PKPACPLCRTEL.NLGSQEPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAI
DSQ  CCCAAACCAGCCTGTCCTCTCTGTAGAACTGAGCTC...AACCTAGGGTCTCAGGAGCCTCCCAACTTCAACACCTGCACAGAATGCAAGAATCAAGTTTGCAATCTCTGTGGATTTAACCCAACGCCCCACCTGACTGAGATTCAAGAGTGGCTTTGTTTAAACTGCCAGACACAGAGAGCAATT
TRN  10010101100011010
NAM  PCLO_CHICK/832-892
ASQ  PKVSCPLCKTGL.NIGSKDPPNFNTCTECKKVVCNLCGFNPMPHIVEVQEWLCLNCQTQRAM
DSQ  CCTAAGGTGTCTTGTCCCCTTTGTAAAACTGGACTA...AATATTGGTTCTAAGGATCCTCCCAACTTTAATACGTGTACGGAGTGCAAGAAGGTTGTGTGCAACCTCTGTGGATTTAACCCAATGCCACACATAGTTGAGGTACAGGAATGGCTGTGCTTAAACTGTCAGACCCAAAGGGCAATG
TRN  10010101100011010
NAM  BSN_RAT/457-517
ASQ  ERAACPLCQAEL.NVGSRGPANYNTCTACKLRVCTLCGFNPTPHLVEKTEWLCLNCQTKRLL
DSQ  GAAAGGGCTGCCTGCCCACTGTGCCAAGCCGAGCTC...AACGTGGGTAGCAGGGGCCCAGCCAACTACAATACCTGCACTGCCTGCAAGCTCCGGGTGTGCACCCTGTGTGGCTTTAACCCGACACCACACCTGGTGGAGAAAACAGAGTGGCTCTGTCTGAACTGCCAAACCAAGAGGCTGCTG
TRN  10010101100011011
NAM  BSN_MOUSE/459-519
ASQ  RAAACPLCQAEL.NVGSRGPANYNTCTACKLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLL
DSQ  AGGGCCGCCGCCTGCCCACTGTGCCAAGCCGAGCTC...AATGTGGGTAGCAGGGGCCCAGCCAACTACAACACCTGCACTGCCTGCAAGCTCCAGGTGTGCAACCTGTGTGGCTTTAACCCAACACCGCACCTGGTGGAGAAAACAGAGTGGCTCTGTCTGAACTGCCAAACTAAGCGGCTGCTG
TRN  10010101100011011
NAM  BSN_HUMAN/460-520
ASQ  ERAICPLCQAEL.NVGSKSPANYNTCTTCRLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLL
DSQ  GAAAGGGCCATCTGCCCACTGTGCCAAGCCGAGCTC...AACGTGGGCAGCAAGAGCCCAGCCAACTATAACACATGCACCACCTGCAGGCTCCAGGTGTGCAACCTGTGTGGCTTCAACCCAACACCCCACCTGGTGGAGAAAACAGAGTGGCTCTGTCTGAACTGCCAAACCAAGCGGCTACTG
TRN  10010101100011011
NAM  PCLO_MOUSE/498-559
ASQ  SKTICPLCNTTElLLHTPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQRAL
DSQ  TCTAAAACCATCTGTCCTCTTTGCAACACCACTGAGcttCTGTTGCATACTCCAGAAAAGGCCAATTTTAACACATGTACTGAGTGTCAAAGCACCGTGTGTAGCCTCTGTGGTTTTAACCCCAATCCTCACTTAACTGAGATCAAAGAGTGGCTCTGTTTAAACTGTCAGATGCAAAGAGCTCTG
TRN  10010101100011010
NAM  PCLO_RAT/519-580
ASQ  SKTICPLCNTTElLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQRAL
DSQ  TCGAAAACCATCTGTCCTCTTTGCAACACCACTGAActtCTGTTGCATATTCCAGAAAAGGCCAATTTTAACACATGCACTGAGTGTCAAAGCACCGTCTGTAGCCTCTGTGGTTTTAACCCCAACCCTCATTTAACTGAGATCAAAGAGTGGCTCTGTTTAAACTGTCAGATGCAAAGAGCTCTA
TRN  10010101100011010
NAM  PCLO_CHICK/364-425
ASQ  KKTFCPLCTTTElLLHTPEKANYNTCTQCHTVVCSLCGFNPNPHITEIKEWLCLNCQMQRAL
DSQ  AAGAAAACCTTTTGTCCTCTTTGCACTACCACTGAGctgCTGCTGCACACGCCAGAAAAGGCCAATTACAATACATGCACACAGTGTCATACTGTAGTCTGCAGTCTGTGTGGATTTAATCCTAACCCTCATATAACAGAGATTAAAGAATGGCTCTGTTTAAACTGCCAGATGCAAAGAGCATTA
TRN  10010101100011010
NAM  BSN_RAT/162-222
ASQ  SSTLCPICKTSD.LTSTSSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL
DSQ  AGCAGCACCCTGTGTCCAATATGCAAGACATCGGAC...CTCACATCAACCTCCAGCCAGCCAAACTTCAACACCTGCACCCAGTGTCACAACAAGGTCTGCAACCAATGTGGGTTCAACCCCAACCCTCACCTCACCCAGGTGAAGGAGTGGCTCTGTTTGAACTGTCAGATGCAGAGGGCCCTG
TRN  10010101100011001
NAM  BSN_MOUSE/162-222
ASQ  SSTLCPICKTSD.LTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL
DSQ  AGCAGCACCCTGTGTCCAATATGCAAGACCTCGGAC...CTCACATCAACCCCCAGCCAGCCAAACTTCAACACCTGCACCCAGTGTCACAACAAGGTCTGCAACCAATGTGGGTTCAACCCCAACCCTCACCTCACCCAGGTGAAGGAGTGGCTCTGTTTGAACTGTCAGATGCAGAGGGCCCTA
TRN  10010101100011001
NAM  BSN_HUMAN/165-225
ASQ  SSTLCPICKTSD.LTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL
DSQ  AGCAGCACGCTGTGTCCCATATGCAAGACTTCGGAC...CTCACGTCGACCCCCAGCCAGCCAAACTTCAACACCTGCACCCAGTGTCACAACAAGGTCTGCAACCAGTGTGGGTTCAACCCCAACCCTCATCTCACCCAGGTGAAGGAGTGGCTCTGTCTGAACTGTCAGATGCAGAGGGCTCTG
TRN  10010101100011011
//