EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05705 - DUF829)
FAM  PF05705
PID  DUF829
DES  Eukaryotic protein of unknown function (DUF829)
IPR  IPR008547
ANO  11
ALN  296
AID  0.188698
APH  (((Q9C445_PENPX/34-287:1.55845,((Q8SXH2_DROME/74-317:0.87827,((Q17846_CAEEL/53-289:0.49362,Q9TZH8_CAEEL/67-320:0.52276):0.66672,(Q22750_CAEEL/59-309:0.66774,Q9TZH9_CAEEL/13-269:1.08367):0.25693):0.34852):0.19097,Q8MLS7_DROME/71-302:1.40660):0.18505):0.34738,(Q8LG51_ARATH/121-389:0.47797,Q9LHE8_ARATH/161-425:0.48339):0.14910):3.70610,Q8S8H8_ARATH/104-385:0.34055,Q9FFG7_ARATH/96-379:0.46162);
ATP  (((Q9C445_PENPX/34-287,((Q8SXH2_DROME/74-317,((Q17846_CAEEL/53-289,Q9TZH8_CAEEL/67-320),(Q22750_CAEEL/59-309,Q9TZH9_CAEEL/13-269))),Q8MLS7_DROME/71-302)),(Q8LG51_ARATH/121-389,Q9LHE8_ARATH/161-425)),Q8S8H8_ARATH/104-385,Q9FFG7_ARATH/96-379);
ATL  14.2357
DNO  10
DLN  888
DID  0.341359
DPH  ((Q9TZH8_CAEEL/67-320:0.69266,(Q22750_CAEEL/59-309:0.49223,Q9TZH9_CAEEL/13-269:0.59743):0.14546):0.12243,((Q8LG51_ARATH/121-389:0.38070,Q9LHE8_ARATH/161-425:0.36044):0.00000,(Q8S8H8_ARATH/104-385:0.29101,Q9FFG7_ARATH/96-379:0.34697):1.66239):0.34728,(Q8SXH2_DROME/74-317:0.58993,(Q8MLS7_DROME/71-302:0.78051,Q9C445_PENPX/34-287:0.75203):0.13969):0.14820);
DTP  ((Q9TZH8_CAEEL/67-320,(Q22750_CAEEL/59-309,Q9TZH9_CAEEL/13-269)),((Q8LG51_ARATH/121-389,Q9LHE8_ARATH/161-425),(Q8S8H8_ARATH/104-385,Q9FFG7_ARATH/96-379)),(Q8SXH2_DROME/74-317,(Q8MLS7_DROME/71-302,Q9C445_PENPX/34-287)));
DTL  7.84936
RID  0.182007
RPH  ((((Q8MLS7_DROME/71-302:1.42397,(Q8SXH2_DROME/74-317:0.84129,(Q9TZH8_CAEEL/67-320:1.04722,(Q22750_CAEEL/59-309:0.65300,Q9TZH9_CAEEL/13-269:1.10315):0.26130):0.34394):0.22353):0.15246,Q9C445_PENPX/34-287:1.54021):0.37006,(Q8LG51_ARATH/121-389:0.48022,Q9LHE8_ARATH/161-425:0.48139):0.15623):3.69515,Q8S8H8_ARATH/104-385:0.34739,Q9FFG7_ARATH/96-379:0.45475);
RTP  ((((Q8MLS7_DROME/71-302,(Q8SXH2_DROME/74-317,(Q9TZH8_CAEEL/67-320,(Q22750_CAEEL/59-309,Q9TZH9_CAEEL/13-269)))),Q9C445_PENPX/34-287),(Q8LG51_ARATH/121-389,Q9LHE8_ARATH/161-425)),Q8S8H8_ARATH/104-385,Q9FFG7_ARATH/96-379);
RTL  13.5746
LNK  Q17846_CAEEL/53-289:Q17846:
LNK  Q22750_CAEEL/59-309:Q22750:Z54216
LNK  Q8LG51_ARATH/121-389:Q8LG51:AY084460
LNK  Q8MLS7_DROME/71-302:Q8MLS7:AE003459
LNK  Q8S8H8_ARATH/104-385:Q8S8H8:AC006248
LNK  Q8SXH2_DROME/74-317:Q8SXH2:AY089637
LNK  Q9C445_PENPX/34-287:Q9C445:AF279808
LNK  Q9FFG7_ARATH/96-379:Q9FFG7:AB005239
LNK  Q9LHE8_ARATH/161-425:Q9LHE8:AP002050
LNK  Q9TZH8_CAEEL/67-320:Q9TZH8:AF098993
LNK  Q9TZH9_CAEEL/13-269:Q9TZH9:AF098993
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9TZH9_CAEEL/13-269
ASQ  RDTIVALLGWA-----GAVDRNVEKYAGIYQ---KKGYTTVQFTALAAVKGWGTKDGRN------VDHLASTLDSVLINPSNR--LVFHVFSMNGFIALTSLDSQFPELK----AIEKCDGIFMDSCPAcFSFSIENMQKHALVMNHVYDQLIKNS--..--------NFVLGNFYKVYKKWETARFGYQMIMDTMSIKAG.LCTIEEANPFFYLLNHPHLPPILTSIFSDNDIVCSADEINLFNECAAK--KSDKKRQIMATRLKDTAH----VEHFRKYPKLYLEKMDEFLQKV
DSQ  CGTGACACAATCGTTGCATTACTTGGATGGGCG---------------GGAGCTGTTGACAGAAATGTGGAGAAATATGCAGGGATTTATCAA---------AAGAAAGGGTACACAACAGTTCAATTCACAGCTCTTGCGGCTGTTAAAGGATGGGGAACTAAGGATGGTAGAAAT------------------GTGGATCATCTAGCAAGCACACTTGACTCTGTCCTTATAAATCCTTCAAATCGT------CTTGTATTTCATGTATTCTCTATGAATGGATTTATTGCACTCACTTCTCTTGATTCACAATTTCCAGAATTAAAA------------GCAATTGAAAAATGCGATGGAATATTTATGGATTCATGTCCAGCAtgcTTCTCTTTTTCAATTGAGAATATGCAAAAACATGCATTGGTCATGAATCATGTTTATGATCAATTGATCAAAAACTCG------......------------------------AATTTCGTACTTGGAAACTTTTATAAAGTTTACAAGAAATGGGAAACAGCAAGGTTTGGATATCAAATGATTATGGACACAATGTCTATAAAAGCTGGA...TTGTGTACAATTGAAGAGGCAAATCCGTTCTTTTATCTATTGAATCATCCACATCTTCCACCAATCTTAACTTCTATTTTTTCCGATAATGACATTGTTTGTTCTGCTGATGAAATCAACTTATTCAACGAGTGTGCTGCAAAG------AAAAGTGATAAGAAGAGACAAATCATGGCGACTAGGCTAAAAGATACTGCACAC------------GTCGAACACTTCAGAAAGTATCCGAAATTATATTTGGAGAAAATGGACGAGTTTTTGCAAAAAGTG
TRN  10010101110011000
NAM  Q22750_CAEEL/59-309
ASQ  SKTLVVLFGWA-----GCRDRYLSKYAQYYQ---DAGISTVRFTAPIAKIRSFSSYRPF----ALCFHRILNEILHDQNDITT--IYFHVFSMNGCSLLAAYWDQLQDLENGKEVLSKSRGLIFDSCPA.FTSPSQSAQAISFATLPPSHY--HGA--..----------LRGSYRAVLYTFFSFHRG-VLWLRSFLEK--.-DIYERHYAYFKMITFDNLPAKQLYIYGPADLVCSEESIEEYAQLMEQ-----RGVSISKLRLLDSLH----CQHLRSHPVTYTQECLDFVKSG
DSQ  TCGAAAACTCTCGTTGTACTGTTCGGATGGGCC---------------GGTTGTAGGGACCGATACTTGTCGAAATACGCACAGTATTATCAG---------GATGCAGGAATTTCTACAGTAAGATTTACTGCTCCAATCGCTAAAATCCGAAGTTTTTCGTCATATCGCCCGTTT------------GCATTGTGCTTTCATCGAATTCTGAATGAGATTCTCCACGACCAAAATGACATCACAACA------ATCTACTTCCACGTATTCTCTATGAATGGATGCTCTTTGCTCGCAGCATACTGGGATCAATTACAAGATCTCGAGAATGGAAAAGAAGTTCTTTCAAAATCCAGAGGACTTATCTTCGATAGTTGTCCAGCA...TTCACTAGTCCATCTCAAAGTGCACAGGCTATCTCGTTTGCCACACTTCCACCGAGTCATTAC------CACGGAGCA------......------------------------------TTGAGAGGATCATATCGAGCAGTTCTTTATACATTCTTCTCATTTCATAGAGGA---GTTTTGTGGTTGAGATCATTCTTGGAGAAG------...---GATATCTACGAGAGACACTATGCGTATTTCAAAATGATAACATTTGACAATCTACCGGCGAAGCAGCTCTATATTTATGGACCTGCAGACTTAGTTTGCTCCGAAGAATCCATCGAAGAATACGCCCAGTTAATGGAGCAA---------------CGTGGTGTTTCAATCTCAAAACTTCGTCTTCTCGATTCTTTGCAC------------TGCCAACATCTCCGATCTCATCCCGTGACGTACACTCAAGAATGCCTAGACTTTGTGAAATCAGGC
TRN  10010101100011000
NAM  Q9TZH8_CAEEL/67-320
ASQ  KKPVILMVGWA-----GANPKHIDKYIKVYN---DEGYRVVSLCPPCYHYSIPNSRVGFYMSP-LFRAIDAKPGDFRSFAKCP--IIVHSFSMNGVRGLISFWKWTEAEE-KPQLRERIKGIIFDSAPS.RPYGKQDATAMVISTPPIDAFER-----..---------WISEQTRISVLTWFLNLRAYLQIPLLTMVP--.-FLRSFVSIYYYLQTHIALPRDQLYLYSKADTMIKAKHVEKFIEKQKE-----KGNSVTAIDFVDSEH----VAHIRTHPKDYRTACLNFVRHV
DSQ  AAAAAACCAGTTATTCTGATGGTTGGATGGGCT---------------GGAGCAAATCCAAAGCATATCGACAAGTATATTAAAGTTTATAAT---------GATGAAGGATATCGAGTTGTCTCCCTCTGTCCACCATGTTATCACTATAGTATTCCAAATTCTCGTGTTGGATTCTACATGTCACCA---CTTTTCAGAGCAATTGATGCAAAACCCGGAGATTTCAGATCATTTGCCAAATGTCCA------ATAATTGTTCACTCATTTTCAATGAACGGAGTACGCGGATTAATTTCATTTTGGAAATGGACAGAAGCAGAGGAA---AAACCACAATTAAGAGAACGAATTAAAGGAATTATTTTCGATAGTGCCCCATCG...CGCCCATATGGAAAACAAGACGCTACGGCAATGGTCATTTCAACTCCTCCAATTGATGCATTTGAACGA---------------......---------------------------TGGATTAGTGAGCAAACGAGAATTTCTGTGCTTACTTGGTTCTTGAATCTACGAGCTTACTTGCAAATCCCACTTCTTACGATGGTTCCA------...---TTTTTACGTTCGTTTGTGTCAATCTACTATTATCTTCAAACACATATTGCCCTGCCACGTGATCAACTGTATTTATACTCTAAAGCTGACACTATGATCAAGGCGAAACATGTCGAGAAATTCATTGAAAAACAAAAAGAA---------------AAAGGAAATTCAGTGACCGCTATTGATTTCGTCGACTCTGAGCAT------------GTTGCACACATTCGAACACATCCAAAAGATTACCGTACAGCTTGCCTGAACTTTGTTAGACACGTC
TRN  10010101100011000
NAM  Q17846_CAEEL/53-289
ASQ  SKPVVLMIGWA-----GAANKHMEKYSKLYN---DKGYDVALICPPTFSFTVPNNSIGKR-----MLPILEKYG------NSP--IMIHSFSINGIRGIVSLAKATGNPK----LFDNVQGIIFDSAPS.IPFPHQNGKAMMLSTPSVTY--------..----------MKDETRQKIYELVNAVRDKLLSPLVTLLP--.-FLRPYFFSYWYIHDKIELPKRQVYFYSHGDSMVPYDLLEKFVEIQRK-----RGCHVENLNFGDTEH----VAHFRAKPAVYSDKCVEFISKL
NAM  Q9LHE8_ARATH/161-425
ASQ  NRTVVVLLGWL-----GSKQKHLKKYADWYT---SKGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWL--DEEQKKN--LVFHTFSNTGWLTYGAILEKFQKQD--SSLMGRVKGCIVDSAPV.AAADPTVWASGFSAAFLKKSS--VATKGsaSSSYESNGINISQPKPAATETALLLVLE-KFFAVILNLP--.-KVNRRLADVLDTLSTAQPSCPQLYIYSSADRVIPVEQVESFIVEQRK-----AGHEVRACNFISSPH----VDHFRSNPELYTAELNHFMNNF
DSQ  AATAGAACTGTTGTGGTTTTGCTTGGATGGCTT---------------GGATCAAAGCAGAAGCATCTGAAGAAATATGCTGATTGGTACACT---------TCAAAGGGTTACCATGTCATTACATTTACTCTTCCGATGAATGAGATTATGAGTTATCAAGTTGGAGGGAAAGCAGAGAAGAACATCGAGTCGCTGGTTAATCACTTGGCTGATTGGTTG------GATGAAGAGCAAAAGAAAAAT------CTCGTCTTTCACACCTTCAGCAACACCGGGTGGTTAACATATGGAGCCATTTTGGAAAAGTTTCAGAAGCAAGAT------TCATCATTGATGGGAAGAGTTAAAGGTTGCATAGTGGACTCAGCTCCTGTT...GCTGCTGCAGATCCTACGGTATGGGCATCAGGTTTCTCAGCTGCGTTCTTGAAGAAAAGCAGT------GTAGCCACTAAAGGAtctgcgAGCTCATCATATGAGTCAAACGGTATAAACATCTCCCAGCCTAAACCCGCTGCAACAGAAACAGCTTTGCTTTTGGTTCTTGAA---AAGTTCTTTGCGGTGATTCTAAATCTTCCC------...---AAAGTAAACAGGAGACTTGCCGATGTTCTTGACACATTATCAACAGCACAACCAAGTTGTCCACAGTTATACATTTACAGCTCTGCAGACAGAGTTATACCGGTGGAACAAGTTGAATCATTCATTGTAGAGCAGAGGAAA---------------GCAGGACATGAGGTCCGTGCTTGCAACTTCATATCTTCACCTCAT------------GTAGACCATTTCCGGAGTAACCCAGAACTGTATACAGCTGAGCTCAACCATTTCATGAACAACTTT
TRN  10010101100011000
NAM  Q8LG51_ARATH/121-389
ASQ  KETTVVLLGWL-----GAKAKHLRRYVEWYN---SRGINAVTFTVDVRDLLRLDLGRRLERRIAEFGNELVNWVSEKEDDGREKCLVFHSFSNTGWLVYGALLESFIGRQ---DLVERIEGCIIDSGGA.DPLDTKIWAAGFTAAILKKRSSTITTEP..NSPIKEEDASTPQKKEPLGIENIMLSSLEKLFPIFLNHP--.-DVNTRLTKIIQKLYENHPPCPQLYLYSSGDKVVPSHSVELRIREQQK-----IGRKIHSFNFKSSPH----VDHYRNFPDLYSSQLQNFLQEC
DSQ  AAAGAGACGACGGTGGTTCTCCTTGGTTGGCTA---------------GGAGCGAAAGCTAAACATCTAAGGAGATACGTTGAGTGGTACAAC---------TCCAGGGGAATTAACGCCGTTACTTTCACTGTTGACGTTAGGGATTTGCTCCGGTTAGATCTTGGTCGGCGGCTTGAACGAAGGATAGCTGAATTTGGGAATGAATTGGTTAATTGGGTATCGGAGAAAGAAGATGATGGTAGAGAGAAATGCTTGGTGTTTCACAGCTTCAGTAACACTGGTTGGCTTGTATATGGTGCCTTGCTAGAGAGCTTCATTGGTAGACAA---------GATTTAGTAGAAAGGATTGAGGGTTGTATCATTGACTCGGGAGGAGCA...GATCCTCTTGATACTAAGATTTGGGCAGCGGGGTTTACCGCAGCTATACTGAAGAAGCGTAGCTCCACCATAACCACAGAACCA......AACAGTCCCATAAAAGAAGAGGATGCTTCAACACCACAAAAGAAGGAACCTTTAGGAATCGAAAACATAATGCTATCATCTCTGGAGAAACTCTTCCCCATCTTCTTAAACCACCCA------...---GACGTCAATACGAGGCTAACAAAAATCATTCAAAAACTATATGAGAACCATCCTCCATGTCCTCAGCTCTATCTTTACAGCTCCGGGGACAAAGTTGTTCCATCTCATTCCGTTGAGCTCCGCATCCGAGAACAACAGAAG---------------ATTGGAAGAAAGATACATTCTTTCAATTTCAAGTCCTCTCCTCAC------------GTGGATCATTACCGGAACTTTCCTGACTTGTATTCCTCACAGCTTCAAAACTTCTTGCAAGAATGC
TRN  10010101100011000
NAM  Q8SXH2_DROME/74-317
ASQ  HVPIVMLLGWA-----GCQDRYLMKYSKIYE---ERGLITVRYTAPVDSLFWKRSEMIP------IGEKIIKLIQDMNFDAHP--LIFHIFSNGGAYLYQHINLAVIKHK----SPLQVRGVIFDSAPG.ERRIISLYRAITAIYGREKRC-------..--------NCLAALVITITLSIMWFVEESISALKSLFVP--.-SSPVRPSPFCD-LKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRD-----QGIQVSSVCFEDAEH----VKIYTKYPKQYVQCVCNFIRNC
DSQ  CACGTGCCCATTGTCATGCTGTTGGGGTGGGCG---------------GGCTGTCAGGATCGATACCTCATGAAATACTCAAAAATTTACGAG---------GAGCGGGGCTTAATTACTGTGCGATACACGGCTCCGGTAGACAGCCTATTTTGGAAGCGATCTGAAATGATTCCT------------------ATCGGCGAGAAAATCATTAAACTAATCCAGGACATGAATTTTGACGCCCATCCA------CTAATATTTCACATATTTTCCAATGGCGGAGCCTACTTGTACCAACATATTAATTTAGCTGTGATCAAGCACAAG------------TCTCCGCTGCAAGTTCGCGGCGTGATTTTTGACTCTGCTCCTGGG...GAGCGTAGGATAATAAGCCTGTATCGCGCCATTACAGCCATCTATGGTAGGGAAAAACGCTGC---------------------......------------------------AACTGTTTGGCCGCACTGGTTATAACCATTACACTCAGTATTATGTGGTTTGTGGAGGAATCAATTTCTGCCTTGAAAAGCCTATTCGTGCCG------...---TCTTCGCCAGTACGCCCCAGTCCATTTTGCGAC---CTTAAAAACGAAGCCAATAGATACCCACAGCTTTTTCTGTATTCGAAAGGTGACATTGTGATTCCCTATCGAGATGTGGAAAAATTTATTCGTCTTAGACGCGAT---------------CAGGGTATTCAGGTATCGTCAGTATGCTTTGAGGATGCCGAGCAC------------GTTAAGATTTACACCAAATATCCCAAGCAGTACGTCCAGTGTGTGTGTAATTTTATTAGGAACTGC
TRN  10010101100011000
NAM  Q8MLS7_DROME/71-302
ASQ  GNPLVLMMAWL-----MAKQKHLKKYAQIYT---EMGFDVVVVHITPWQLLWPVKGSQV------VAAETIRFL-ENNKSYEP--IVMHGFSVG---AYQLG-EIMLQMS----RDMDRYGSILD----.-RFVCQVWDSAADIT--EIPVG------..----------VPKSIFPRNERMQSALRNYTLYHLKTFHN--.-QATIHYMRSSQMFHSTLLKAPALFFVSDNDPIGPPSSNQSVREDWER-----ANIKVTFKCWERSQH----AAHYIRHREEYLQTLFQHLETC
DSQ  GGCAACCCACTGGTTCTCATGATGGCCTGGCTG---------------ATGGCCAAGCAGAAGCATCTGAAGAAGTATGCCCAGATCTACACT---------GAGATGGGATTCGATGTGGTGGTGGTGCACATTACGCCGTGGCAGCTACTCTGGCCGGTCAAAGGATCCCAGGTG------------------GTGGCCGCCGAGACTATTCGATTCCTG---GAGAACAACAAGTCGTACGAACCC------ATTGTGATGCATGGCTTCTCCGTGGGC---------GCCTACCAGCTGGGC---GAGATCATGCTGCAGATGTCG------------CGCGACATGGATCGCTATGGTAGCATTCTGGAC------------...---CGCTTCGTGTGCCAGGTGTGGGACAGCGCCGCCGACATCACC------GAGATCCCGGTGGGC------------------......------------------------------GTGCCCAAGTCGATCTTCCCGAGGAACGAGCGAATGCAGAGCGCCCTGCGCAACTATACGCTGTACCACCTGAAGACATTCCACAAC------...---CAGGCCACCATCCACTACATGCGCTCCAGCCAGATGTTCCACTCCACGCTGCTCAAGGCCCCGGCGCTGTTCTTCGTGTCCGACAACGATCCCATCGGTCCGCCGTCCTCCAACCAGTCCGTTCGCGAGGACTGGGAGCGT---------------GCGAACATCAAGGTTACCTTCAAGTGCTGGGAGCGGTCCCAGCAC------------GCCGCCCACTATATACGGCATCGCGAGGAGTACCTGCAGACGCTGTTCCAGCATCTGGAGACCTGC
TRN  10010101100011011
NAM  Q9C445_PENPX/34-287
ASQ  EPTTIIIFGWG-----DGMPKHVSKYADGYHELFPCARIVVVLSRTFQASNQPLDARIEAMLP--VIDTVFPTPTGSGNEDER--VLMHAMSNTGGIFLAAAFTAYQQRH-GADKKLPHTLLVCDSTPGsLDFASQVGRWSRAMAVGTAKY-------..----------FPWPFAMTQGFWWLFLWANYAWELLRGTE--.-PSGVWATRVMNDHSVAPIEPNRLYLYSKEDEIIWWEDLEQAVAEVKR-----QGYTVDLEMFEGSPH----VGHMRLHPEQYWGKISNAWKET
DSQ  GAACCAACAACAATCATCATCTTCGGATGGGGC---------------GACGGCATGCCAAAACACGTCTCAAAATACGCAGACGGATATCATGAACTTTTCCCCTGCGCCAGAATTGTCGTCGTCCTATCTCGCACCTTTCAAGCATCAAATCAACCCCTTGATGCCCGCATTGAAGCCATGTTACCA------GTGATTGATACAGTCTTCCCAACGCCTACGGGAAGCGGCAATGAAGATGAACGA------GTGCTAATGCACGCCATGTCAAATACCGGCGGCATCTTCCTCGCAGCAGCTTTCACGGCATATCAACAACGACAC---GGCGCTGACAAGAAACTCCCTCATACACTCTTGGTATGTGACTCGACACCGGGAagcTTGGACTTTGCATCCCAGGTTGGACGTTGGTCACGAGCAATGGCTGTTGGAACGGCGAAGTAT---------------------......------------------------------TTCCCTTGGCCTTTTGCAATGACGCAAGGGTTTTGGTGGCTTTTCCTTTGGGCAAATTACGCCTGGGAGTTACTTCGTGGTACTGAG------...---CCATCGGGAGTTTGGGCTACACGTGTAATGAATGATCACTCTGTCGCCCCCATCGAACCGAACAGACTCTACCTCTATTCCAAGGAAGATGAGATCATTTGGTGGGAGGATTTAGAGCAGGCTGTTGCTGAGGTGAAGCGC---------------CAGGGCTATACGGTTGACCTTGAAATGTTTGAGGGCTCGCCCCAT------------GTTGGACATATGAGATTGCACCCAGAGCAATATTGGGGCAAGATTTCAAATGCCTGGAAGGAGACC
TRN  10010101110011000
NAM  Q9FFG7_ARATH/96-379
ASQ  GGPNACMYKVLQILEGTCETGLNPDDCRLVRNC-ISGFIYDSCPVDFTSDLGARLAVHPTTLKMSSPPKPFVWAANGIASSLDY-VFLNRFESQRAEYWQTLYSTIIMRV-PYLILCSENDDLAPYQTI.HNFATRLQELGGNVKLVKWNDSPHCG--..--HYRYNQVDYKAAVSEFLSKAASVYSQKTRSLDREAMKGTcHDEITEPIQSLGQSTSGLNRSFNGTPLVTTDHFFVPSTVGYYVGRDGG--YVQDEHKQDLICLSNTQTNESVKPNGVLGQILFDVYIPKNVEDW
DSQ  GGTGGTCCTAATGCTTGTATGTATAAAGTTCTTCAAATACTTGAAGGAACATGCGAAACGGGACTAAATCCGGATGATTGTAGATTGGTTAGAAACTGC---ATCTCAGGGTTTATTTATGACTCATGTCCTGTGGATTTCACTAGCGACTTGGGAGCTCGATTAGCGGTTCATCCAACTACGCTTAAAATGTCTAGTCCACCTAAACCGTTTGTATGGGCAGCGAATGGTATTGCTTCGAGTCTCGATTAT---GTTTTTCTCAACAGGTTTGAATCACAGCGAGCCGAGTACTGGCAGACTCTTTACTCTACTATAATCATGAGAGTA---CCTTATCTCATTCTATGCTCTGAAAACGATGACCTTGCTCCTTATCAAACTATA...CACAATTTCGCTACACGTCTCCAAGAACTAGGAGGAAATGTAAAACTTGTAAAATGGAATGATTCCCCTCATTGTGGT------......------CATTATCGTTATAACCAGGTCGACTATAAAGCTGCTGTATCTGAGTTCTTGTCAAAAGCAGCGTCGGTTTATTCGCAGAAGACGAGAAGTCTTGACAGAGAAGCTATGAAAGGAACAtgtCATGATGAGATAACAGAGCCAATTCAGAGCTTGGGGCAATCAACCTCTGGTCTTAACCGAAGCTTCAACGGAACTCCACTTGTCACAACCGATCATTTCTTCGTACCTAGCACCGTAGGTTACTACGTGGGCAGAGACGGCGGA------TATGTGCAAGATGAACACAAACAAGATTTGATTTGTTTGTCCAATACTCAAACCAATGAATCGGTTAAGCCCAATGGAGTTCTAGGCCAAATCTTATTTGATGTTTATATTCCGAAGAATGTTGAGGATTGG
TRN  10010101110011000
NAM  Q8S8H8_ARATH/104-385
ASQ  GAPKACMYKVLQVIMDDCEAQIHPDDSQLVRTC-LSGHVYDSGPLDFTSDLNVKFALHPTIRRMSGPSRLVSWVAKGISSGLDG-LYLTRFESQRSEYWQALYSSVEIGA-PYLILCSENDELAPLQVI.SSFTHQLQELGGEVKVVKWKNSPHAG--..--HYAHNPIQYRAVISNFLEKAISVHLHKIRQLGERAHT--.HDEISELICDLQKVAVNSNQSLRRVATGPCDHFFLPSSAPYQSNSNNSDPSSSQEEQRERSSFRPLQP-TSINAHSVLGQFLFDSCVPKNIEGW
DSQ  GGTGCTCCTAAAGCTTGTATGTATAAAGTTCTACAGGTGATCATGGATGATTGTGAAGCTCAAATTCATCCGGATGATAGCCAGTTGGTTAGAACCTGT---CTTTCTGGACATGTCTATGACTCTGGCCCGTTGGATTTTACGAGTGATTTGAATGTGAAATTCGCACTACATCCCACCATACGACGAATGTCTGGTCCTTCTAGACTAGTATCTTGGGTGGCTAAAGGGATTTCTTCCGGGCTTGATGGT---TTATATCTTACAAGATTTGAATCCCAACGTAGTGAGTACTGGCAGGCCCTCTACTCATCGGTTGAAATTGGGGCT---CCATATCTCATTTTGTGCTCCGAGAATGATGAACTTGCTCCTCTACAAGTAATT...TCAAGCTTTACCCATCAATTGCAGGAACTGGGAGGAGAAGTTAAGGTTGTCAAGTGGAAAAATTCTCCTCATGCAGGA------......------CACTACGCACATAACCCTATACAATACCGGGCTGTTATCTCCAACTTTCTGGAGAAAGCCATATCAGTTCACTTACATAAAATCCGGCAGCTCGGAGAAAGAGCTCACACG------...CATGATGAAATCTCTGAGTTAATATGCGACCTTCAGAAAGTTGCTGTGAACTCTAACCAAAGCCTAAGAAGAGTAGCCACTGGGCCATGTGACCACTTTTTCTTACCTAGCTCAGCACCGTATCAAAGCAACAGCAACAACAGCGATCCATCATCTTCACAAGAAGAACAGAGAGAAAGATCGTCCTTCCGCCCACTCCAACCA---ACGAGCATAAACGCTCACAGCGTACTCGGGCAATTCCTATTCGACTCATGTGTTCCAAAGAACATCGAAGGATGG
TRN  10010101100011000
//