EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05702 - Herpes_UL49_5)
FAM  PF05702
PID  Herpes_UL49_5
DES  Herpesvirus UL49.5 envelope/tegument protein
IPR  IPR008647
ANO  8
ALN  118
AID  0.324926
APH  (Q9E207_9ALPH/1-87:0.61073,((Q69317_9ALPH/1-95:0.17766,O89248_9ALPH/1-95:0.20795):0.08074,Q9DH60_9ALPH/1-94:0.32966):0.75861,(O56867_9ALPH/1-117:1.26916,((Q9IF47_9ALPH/1-98:0.64664,Q89806_9ALPH/1-91:0.76989):0.11936,Q66598_9ALPH/1-99:0.53626):0.32871):0.08638);
ATP  (Q9E207_9ALPH/1-87,((Q69317_9ALPH/1-95,O89248_9ALPH/1-95),Q9DH60_9ALPH/1-94),(O56867_9ALPH/1-117,((Q9IF47_9ALPH/1-98,Q89806_9ALPH/1-91),Q66598_9ALPH/1-99)));
ATL  5.92175
DNO  8
DLN  354
DID  0.425692
DPH  (Q9IF47_9ALPH/1-98:0.55075,(Q66598_9ALPH/1-99:0.42607,(((Q69317_9ALPH/1-95:0.17843,O89248_9ALPH/1-95:0.19184):0.06091,Q9DH60_9ALPH/1-94:0.31216):0.40963,Q9E207_9ALPH/1-87:0.57790):0.22633):0.14387,(O56867_9ALPH/1-117:0.87576,Q89806_9ALPH/1-91:0.34898):0.24476);
DTP  (Q9IF47_9ALPH/1-98,(Q66598_9ALPH/1-99,(((Q69317_9ALPH/1-95,O89248_9ALPH/1-95),Q9DH60_9ALPH/1-94),Q9E207_9ALPH/1-87)),(O56867_9ALPH/1-117,Q89806_9ALPH/1-91));
DTL  4.54739
RID  0.324926
RPH  (Q9E207_9ALPH/1-87:0.61073,((Q69317_9ALPH/1-95:0.17766,O89248_9ALPH/1-95:0.20795):0.08074,Q9DH60_9ALPH/1-94:0.32966):0.75861,(O56867_9ALPH/1-117:1.26916,((Q9IF47_9ALPH/1-98:0.64664,Q89806_9ALPH/1-91:0.76989):0.11936,Q66598_9ALPH/1-99:0.53626):0.32871):0.08638);
RTP  (Q9E207_9ALPH/1-87,((Q69317_9ALPH/1-95,O89248_9ALPH/1-95),Q9DH60_9ALPH/1-94),(O56867_9ALPH/1-117,((Q9IF47_9ALPH/1-98,Q89806_9ALPH/1-91),Q66598_9ALPH/1-99)));
RTL  5.92175
LNK  O56867_9ALPH/1-117:O56867:Y14300
LNK  O89248_9ALPH/1-95:O89248:AB012572
LNK  Q66598_9ALPH/1-99:Q66598:X17684
LNK  Q69317_9ALPH/1-95:Q69317:L10283
LNK  Q89806_9ALPH/1-91:Q89806:Z54206
LNK  Q9DH60_9ALPH/1-94:Q9DH60:AF291866
LNK  Q9E207_9ALPH/1-87:Q9E207:AF275348
LNK  Q9IF47_9ALPH/1-98:Q9IF47:AF279480
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9E207_9ALPH/1-87
ASQ  M-AS------NCSLELFMLLLLSVFTSAHTT-------------------HKLPEHRN-----FWHASCSARGVYIDGSAIATLFFYASLLGVCVALTALAYNACFRLFTRSVLRSTW
DSQ  ATG---GCTTCA------------------AATTGCTCTTTGGAATTGTTCATGCTTTTATTGCTTTCTGTTTTCACCTCTGCACATACAACG---------------------------------------------------------CACAAATTACCAGAACACAGAAAC---------------TTCTGGCATGCTAGCTGTTCTGCGCGTGGAGTTTATATTGATGGATCTGCTATAGCAACCCTCTTTTTCTACGCGTCTCTATTGGGTGTCTGTGTTGCCTTAACGGCTCTTGCGTATAATGCATGTTTCCGGTTATTTACTCGATCCGTCTTACGTAGTACATGG
TRN  10010101110011000
NAM  Q9DH60_9ALPH/1-94
ASQ  M-GSVGVHHISPSWSVYVIWIVCVHVVLAVD-------------------GERSIAGA----DFWDSTCSAVGVSIAFSSGFSVLFYLGLAAAISALLVGSYSACFRLFTADMFREEW
DSQ  ATG---GGCTCCGTTGGTGTCCATCATATAAGCCCCAGCTGGTCTGTCTATGTGATCTGGATAGTGTGCGTCCACGTGGTTCTAGCAGTCGAC---------------------------------------------------------GGCGAGCGTTCTATAGCCGGCGCA------------GATTTCTGGGATTCTACGTGTTCCGCAGTAGGCGTTTCGATAGCGTTTTCCTCGGGTTTCTCGGTCTTGTTTTATCTAGGTCTGGCAGCCGCAATCTCCGCCCTTCTTGTCGGCTCATATTCCGCATGTTTTCGGTTATTCACCGCGGACATGTTTCGGGAGGAGTGG
TRN  10010111100111000
NAM  O89248_9ALPH/1-95
ASQ  M-GLSDIHHVVCKVLICVIASLVESRATSID-------------------SGRPIAVAG---NFWESTCSAVGVSIAFSSGFSVLFYLGLVAVISALLAGSYHACFRLFTASMFDDGW
DSQ  ATG---GGTTTGTCCGACATCCATCATGTGGTCTGTAAAGTGTTAATTTGCGTAATTGCGTCCCTCGTGGAGTCGCGAGCTACTTCGATCGAT---------------------------------------------------------TCGGGAAGGCCGATCGCCGTGGCAGGA---------AATTTCTGGGAATCTACGTGTTCCGCCGTAGGCGTGTCTATAGCCTTTTCTTCTGGCTTCTCGGTCCTTTTTTATCTAGGTCTGGTGGCGGTAATCTCCGCCCTCTTGGCCGGGTCGTACCATGCATGCTTCCGACTATTCACGGCAAGTATGTTCGATGACGGCTGG
TRN  10010101100011010
NAM  Q69317_9ALPH/1-95
ASQ  M-GLMDIHNAVCSLVIGVAILIATSQATFVD-------------------WGSSITSMG---DFWESTCSAVGVSIAFSSGFSVLFYMGLVAVISALLAGSYHACFRLFTADMFKEEW
DSQ  ATG---GGACTCATGGACATTCATAATGCAGTCTGTAGTTTAGTTATCGGCGTTGCTATTTTGATTGCCACTTCGCAAGCGACGTTTGTCGAT---------------------------------------------------------TGGGGAAGTTCAATCACAAGTATGGGA---------GATTTTTGGGAGTCTACGTGTTCTGCAGTAGGCGTGTCAATAGCTTTTTCATCTGGGTTTTCTGTGCTGTTTTATATGGGTCTGGTGGCGGTAATCTCCGCCCTCTTAGCGGGTTCGTATCACGCATGCTTTCGACTATTCACCGCAGATATGTTTAAAGAGGAGTGG
TRN  10010101100011000
NAM  Q89806_9ALPH/1-91
ASQ  MPRS------PLIVAVVAAALFAIVRGRDPL---------------------LDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKE
DSQ  ATGCCGCGGTCG------------------CCGCTCATCGTTGCGGTTGTGGCCGCCGCGCTGTTTGCCATCGTGCGCGGCCGCGACCCCCTG---------------------------------------------------------------CTAGACGCGATGCGGCGCGAGGGGGCAATGGACTTTTGGAGCGCAGGCTGCTACGCGCGCGGGGTGCCGCTCTCGGAGCCACCGCAGGCCCTGGTTGTTTTTTACGTGGCCCTGACCGCGGTAATGGTCGCCGTGGCCCTGTACGCGTACGGGCTTTGCTTTAGGCTCATGGGCGCCAGCGGGCCCAATAAAAAGGAG
TRN  10010101100011011
NAM  Q9IF47_9ALPH/1-98
ASQ  M-VSSARLSLTLVAALCALVTPALSSIVFSE-------------------GSLPLLREESRTSFWSAACAARGVPVDQPTAAAVTFYICLLAVLVVALGYATRTCARMLHTSPAGRRV
DSQ  ATG---GTCTCCTCCGCCCGGCTCTCGCTGACGCTCGTCGCCGCGCTCTGCGCGCTGGTGACGCCCGCGCTCTCTTCCATCGTCTTTTCCGAG---------------------------------------------------------GGGTCGCTGCCGCTGCTGCGCGAGGAGTCGCGGACCAGCTTCTGGAGCGCCGCCTGCGCCGCCAGGGGAGTCCCGGTGGATCAGCCGACGGCCGCCGCCGTGACATTTTATATCTGCCTCCTGGCGGTGCTCGTCGTCGCCCTGGGTTACGCCACCCGGACGTGCGCCCGGATGCTGCACACCTCCCCCGCGGGGCGGCGCGTA
TRN  10010101100011011
NAM  Q66598_9ALPH/1-99
ASQ  M-LS-ARL-VALAILTCLLVVFGLTRGASGDLEAK---------------QRLDVAREEERRDFWHAACSGHGFPITTPSTAAILFYVSLLAVGVAVACQAYRAFLRIVTLEML-RHL
DSQ  ATG---TTGTCA---GCGAGATTA---GTGGCGCTGGCCATTTTAACCTGCCTTTTGGTGGTGTTTGGTTTGACCAGAGGGGCTAGCGGCGACCTTGAAGCAAAG---------------------------------------------CAACGACTCGACGTTGCAAGAGAAGAAGAGAGGCGCGACTTTTGGCATGCAGCCTGCTCCGGACACGGATTTCCAATTACCACCCCGAGCACTGCAGCTATTCTATTTTATGTGTCTTTGCTTGCAGTAGGCGTGGCCGTTGCTTGCCAGGCATACCGCGCCTTCCTACGAATTGTGACGCTGGAGATGTTG---CGACACCTA
TRN  10010101100011000
NAM  O56867_9ALPH/1-117
ASQ  M-RLPWERSFMLLGAVVYLLHLALVFAQPGVTPGHGMEHGYYGLGAGNMLGAENSMYSANMEHFYHSACSSRGFSLVNGTAASVFFFISLAVALIGLLAVLYNGCFNSFKSSVISSRW
DSQ  ATG---AGGCTGCCGTGGGAAAGGAGTTTTATGCTGTTGGGAGCAGTGGTGTATTTGCTGCATTTGGCACTAGTATTCGCGCAACCGGGTGTGACACCAGGACACGGAATGGAGCATGGGTATTATGGTCTTGGCGCTGGAAATATGCTTGGAGCGGAAAATTCGATGTATAGCGCGAACATGGAACACTTTTACCACAGTGCCTGCTCGTCGCGCGGATTTTCCTTAGTAAACGGAACAGCTGCTTCCGTTTTCTTTTTCATTAGCCTGGCAGTGGCGTTGATTGGCCTGCTGGCCGTGCTATATAACGGTTGTTTCAACAGCTTTAAAAGCAGTGTCATTAGTTCTCGATGG
TRN  10010101100011010
//